Recombinant Human AAPLN protein, GST-tagged

• Cat.No.: AAPLN-505H
• Product Overview: Human AAPLN full-length ORF (AAH21104.1, 1 a.a. ~ 122 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a peptide that functions as an endogenous ligand for the G-protein coupled apelin receptor. The encoded preproprotein is proteolytically processed into biologically active C-terminal peptide fragments. These peptide fragments activate different tissue specific signaling pathways that regulate diverse biological functions including fluid homeostasis, cardiovascular function and insulin secretion. This protein also functions as a coreceptor for the human immunodeficiency virus 1. [provided by RefSeq, Feb 2016]
• Molecular Mass: 39.16 kDa
• AA Sequence: MSATWCSPEGQGMGQGPGREVGGNSAASGPASPIRDPCLSEAGLKGPPSAHPRRLCLLHRLVCFSGGLTSIQLSPRTCCSHQWAQLFSPACFPQWRAPGCSLDDSRSLTRIRPVHLPGPSLD
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: APLN apelin [ Homo sapiens ]
• Official Symbol: APLN
• Synonyms: APLN; apelin; APEL; XNPEP2; AGTRL1 ligand; APJ endogenous ligand; apelin
• Gene ID: 8862
• mRNA Refseq: NM_017413
• Protein Refseq: NP_059109
• MIM: 300297
• UniProt ID: Q9ULZ1