Recombinant Human ABCC5 Protein, GST-Tagged

Cat.No. : ABCC5-049H
Product Overview : Human ABCC5 full-length ORF ( NP_001018881.1, 1 a.a. - 208 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions in the cellular export of its substrate, cyclic nucleotides. This export contributes to the degradation of phosphodiesterases and possibly an elimination pathway for cyclic nucleotides. Studies show that this protein provides resistance to thiopurine anticancer drugs, 6-mercatopurine and thioguanine, and the anti-HIV drug 9-(2-phosphonylmethoxyethyl)adenine. This protein may be involved in resistance to thiopurines in acute lymphoblastic leukemia and antiretroviral nucleoside analogs in HIV-infected patients. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016]
Molecular Mass : 50.1 kDa
AA Sequence : MKDIDIGKEYIIPSPGYRSVRERTSTSGTHRDREDSKFRRTRPLECQDALETAARAEGLSLDASMHSQLRILDEEHPKGKYHHGLSALKPIRTTSKHQHPVDNAGLFSCMTFSWLSSLARVAHKKGELSMEDVWSLSKHESSDVNCRRLERLWQEELNEVGPDAASLRRVVWIFCRTRLILSIVCLMITQLAGFSGPNFQDGCILRSE
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ABCC5 ATP-binding cassette, sub-family C (CFTR/MRP), member 5 [ Homo sapiens ]
Official Symbol ABCC5
Synonyms ABCC5; ATP-binding cassette, sub-family C (CFTR/MRP), member 5; multidrug resistance-associated protein 5; EST277145; MOAT C; MRP5; SMRP; ATP-binding cassette sub-family C member 5; multi-specific organic anion transporter C; canalicular multispecific organic anion transporter C; ABC33; MOATC; MOAT-C; pABC11; DKFZp686C1782;
Gene ID 10057
mRNA Refseq NM_001023587
Protein Refseq NP_001018881
MIM 605251
UniProt ID O15440

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All ABCC5 Products

Required fields are marked with *

My Review for All ABCC5 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon