Recombinant Human ABCC5 Protein, GST-Tagged
| Cat.No. : | ABCC5-049H |
| Product Overview : | Human ABCC5 full-length ORF ( NP_001018881.1, 1 a.a. - 208 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | The protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. This protein functions in the cellular export of its substrate, cyclic nucleotides. This export contributes to the degradation of phosphodiesterases and possibly an elimination pathway for cyclic nucleotides. Studies show that this protein provides resistance to thiopurine anticancer drugs, 6-mercatopurine and thioguanine, and the anti-HIV drug 9-(2-phosphonylmethoxyethyl)adenine. This protein may be involved in resistance to thiopurines in acute lymphoblastic leukemia and antiretroviral nucleoside analogs in HIV-infected patients. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2016] |
| Molecular Mass : | 50.1 kDa |
| AA Sequence : | MKDIDIGKEYIIPSPGYRSVRERTSTSGTHRDREDSKFRRTRPLECQDALETAARAEGLSLDASMHSQLRILDEEHPKGKYHHGLSALKPIRTTSKHQHPVDNAGLFSCMTFSWLSSLARVAHKKGELSMEDVWSLSKHESSDVNCRRLERLWQEELNEVGPDAASLRRVVWIFCRTRLILSIVCLMITQLAGFSGPNFQDGCILRSE |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ABCC5 ATP-binding cassette, sub-family C (CFTR/MRP), member 5 [ Homo sapiens ] |
| Official Symbol | ABCC5 |
| Synonyms | ABCC5; ATP-binding cassette, sub-family C (CFTR/MRP), member 5; multidrug resistance-associated protein 5; EST277145; MOAT C; MRP5; SMRP; ATP-binding cassette sub-family C member 5; multi-specific organic anion transporter C; canalicular multispecific organic anion transporter C; ABC33; MOATC; MOAT-C; pABC11; DKFZp686C1782; |
| Gene ID | 10057 |
| mRNA Refseq | NM_001023587 |
| Protein Refseq | NP_001018881 |
| MIM | 605251 |
| UniProt ID | O15440 |
| ◆ Recombinant Proteins | ||
| ABCC5-61R | Recombinant Rat ABCC5 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ABCC5-049H | Recombinant Human ABCC5 Protein, GST-Tagged | +Inquiry |
| ABCC5-3965H | Recombinant Human ABCC5 protein, His-tagged | +Inquiry |
| ABCC5-0105H | Recombinant Human ABCC5 Protein (M1-G1437), eGFP, Strep II, 10×His tagged | +Inquiry |
| ABCC5-10R | Recombinant Rhesus Macaque ABCC5 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABCC5 Products
Required fields are marked with *
My Review for All ABCC5 Products
Required fields are marked with *
