Recombinant Human ABHD14B Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : ABHD14B-1521H
Product Overview : ABHD14B MS Standard C13 and N15-labeled recombinant protein (NP_116139) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : ABHD14B (Abhydrolase Domain Containing 14B) is a Protein Coding gene. Diseases associated with ABHD14B include Hypotonia-Cystinuria Syndrome. Among its related pathways are Cytochrome P450 - arranged by substrate type and Metabolism. Gene Ontology (GO) annotations related to this gene include hydrolase activity. An important paralog of this gene is ABHD14A.
Molecular Mass : 22.3 kDa
AA Sequence : MAASVEQREGTIQVQGQALFFREALPGSGQARFSVLLLHGIRFSSETWQNLGTLHRLAQAGYRAVAIDLPGLGHSKEAAAPAPIGELAPGSFLAAVVDALELGPPVVISPSLSGMYSLPFLTAPGSQLPGFVPVAPICTDKINAANYASVKTPALIVYGDQDPMGQTSFEHLKQLPNHRVLIMKGAGHPCYLDKPEEWHTGLLDFLQGLQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name ABHD14B abhydrolase domain containing 14B [ Homo sapiens (human) ]
Official Symbol ABHD14B
Synonyms ABHD14B; abhydrolase domain containing 14B; abhydrolase domain-containing protein 14B; CIB; MGC15429; CCG1-interacting factor B; cell cycle gene 1-interacting factor B;
Gene ID 84836
mRNA Refseq NM_032750
Protein Refseq NP_116139
UniProt ID Q96IU4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ABHD14B Products

Required fields are marked with *

My Review for All ABHD14B Products

Required fields are marked with *

0
cart-icon
0
compare icon