Recombinant Human ABHD14B Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | ABHD14B-1521H |
| Product Overview : | ABHD14B MS Standard C13 and N15-labeled recombinant protein (NP_116139) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | ABHD14B (Abhydrolase Domain Containing 14B) is a Protein Coding gene. Diseases associated with ABHD14B include Hypotonia-Cystinuria Syndrome. Among its related pathways are Cytochrome P450 - arranged by substrate type and Metabolism. Gene Ontology (GO) annotations related to this gene include hydrolase activity. An important paralog of this gene is ABHD14A. |
| Molecular Mass : | 22.3 kDa |
| AA Sequence : | MAASVEQREGTIQVQGQALFFREALPGSGQARFSVLLLHGIRFSSETWQNLGTLHRLAQAGYRAVAIDLPGLGHSKEAAAPAPIGELAPGSFLAAVVDALELGPPVVISPSLSGMYSLPFLTAPGSQLPGFVPVAPICTDKINAANYASVKTPALIVYGDQDPMGQTSFEHLKQLPNHRVLIMKGAGHPCYLDKPEEWHTGLLDFLQGLQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | ABHD14B abhydrolase domain containing 14B [ Homo sapiens (human) ] |
| Official Symbol | ABHD14B |
| Synonyms | ABHD14B; abhydrolase domain containing 14B; abhydrolase domain-containing protein 14B; CIB; MGC15429; CCG1-interacting factor B; cell cycle gene 1-interacting factor B; |
| Gene ID | 84836 |
| mRNA Refseq | NM_032750 |
| Protein Refseq | NP_116139 |
| UniProt ID | Q96IU4 |
| ◆ Recombinant Proteins | ||
| ABHD14B-17R | Recombinant Rhesus Macaque ABHD14B Protein, His (Fc)-Avi-tagged | +Inquiry |
| ABHD14B-7379H | Recombinant Human ABHD14B protein(Met1-Gln210), His-tagged | +Inquiry |
| Abhd14b-1469M | Recombinant Mouse Abhd14b Protein, Myc/DDK-tagged | +Inquiry |
| ABHD14B-75R | Recombinant Rat ABHD14B Protein, His (Fc)-Avi-tagged | +Inquiry |
| ABHD14B-420R | Recombinant Rat ABHD14B Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ABHD14B-9136HCL | Recombinant Human ABHD14B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABHD14B Products
Required fields are marked with *
My Review for All ABHD14B Products
Required fields are marked with *
