Recombinant Human ABHD17A Protein, GST-tagged

Cat.No. : ABHD17A-3669H
Product Overview : Human FAM108A1 full-length ORF ( NP_112490.2, 1 a.a. - 361 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : ABHD17A (Abhydrolase Domain Containing 17A) is a Protein Coding gene. GO annotations related to this gene include hydrolase activity. An important paralog of this gene is ABHD17C.
Molecular Mass : 65.5 kDa
AA Sequence : MNGLSLSELCCLFCCPPCPGRIAAKLAFLPPEATYSLVPEPEPGPGGAGAAPLGTLRASSGAPGRWKLHLTERADFQYSQRELDTIEVFPTKSARGNRVSCMYVRCVPGARQGHQAQGGHPQLAWVGRLGDSNNPAPGGCLLGESWGTGAALACGYIHLLARYTVLFSHGNAVDLGQMSSFYIGLGSRLHCNIFSYDYSGYGASSGRPSERNLYADIDAAWQALRTRYGISPDSIILYGQSIGTVPTVDLASRYECAAVVLHSPLTSGMRVAFPDTKKTYCFDAFPNIEKVSKITSPVLIIHGTEDEVIDFSHGLALYERCPKAVEPLWVEGAGHNDIELYSQYLERLRRFISQELPSQRA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ABHD17A abhydrolase domain containing 17A [ Homo sapiens (human) ]
Official Symbol ABHD17A
Synonyms FAM108A1; family with sequence similarity 108, member A1; C19orf27, chromosome 19 open reading frame 27; abhydrolase domain-containing protein FAM108A1; MGC5244; C19orf27; ABHD17A; abhydrolase domain containing 17A
Gene ID 81926
mRNA Refseq NM_001130111
Protein Refseq NP_001123583
UniProt ID Q96GS6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ABHD17A Products

Required fields are marked with *

My Review for All ABHD17A Products

Required fields are marked with *

0
cart-icon