Recombinant Human ABHD17A Protein, GST-tagged
Cat.No. : | ABHD17A-3669H |
Product Overview : | Human FAM108A1 full-length ORF ( NP_112490.2, 1 a.a. - 361 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ABHD17A (Abhydrolase Domain Containing 17A) is a Protein Coding gene. GO annotations related to this gene include hydrolase activity. An important paralog of this gene is ABHD17C. |
Molecular Mass : | 65.5 kDa |
AA Sequence : | MNGLSLSELCCLFCCPPCPGRIAAKLAFLPPEATYSLVPEPEPGPGGAGAAPLGTLRASSGAPGRWKLHLTERADFQYSQRELDTIEVFPTKSARGNRVSCMYVRCVPGARQGHQAQGGHPQLAWVGRLGDSNNPAPGGCLLGESWGTGAALACGYIHLLARYTVLFSHGNAVDLGQMSSFYIGLGSRLHCNIFSYDYSGYGASSGRPSERNLYADIDAAWQALRTRYGISPDSIILYGQSIGTVPTVDLASRYECAAVVLHSPLTSGMRVAFPDTKKTYCFDAFPNIEKVSKITSPVLIIHGTEDEVIDFSHGLALYERCPKAVEPLWVEGAGHNDIELYSQYLERLRRFISQELPSQRA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ABHD17A abhydrolase domain containing 17A [ Homo sapiens (human) ] |
Official Symbol | ABHD17A |
Synonyms | FAM108A1; family with sequence similarity 108, member A1; C19orf27, chromosome 19 open reading frame 27; abhydrolase domain-containing protein FAM108A1; MGC5244; C19orf27; ABHD17A; abhydrolase domain containing 17A |
Gene ID | 81926 |
mRNA Refseq | NM_001130111 |
Protein Refseq | NP_001123583 |
UniProt ID | Q96GS6 |
◆ Recombinant Proteins | ||
ABHD17A-3669H | Recombinant Human ABHD17A Protein, GST-tagged | +Inquiry |
ABHD17A-4463HF | Recombinant Full Length Human ABHD17A Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABHD17A Products
Required fields are marked with *
My Review for All ABHD17A Products
Required fields are marked with *