Recombinant Human ABHD17A Protein, GST-tagged

• Cat.No.: ABHD17A-3669H
• Product Overview: Human FAM108A1 full-length ORF ( NP_112490.2, 1 a.a. - 361 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: ABHD17A (Abhydrolase Domain Containing 17A) is a Protein Coding gene. GO annotations related to this gene include hydrolase activity. An important paralog of this gene is ABHD17C.
• Molecular Mass: 65.5 kDa
• AA Sequence: MNGLSLSELCCLFCCPPCPGRIAAKLAFLPPEATYSLVPEPEPGPGGAGAAPLGTLRASSGAPGRWKLHLTERADFQYSQRELDTIEVFPTKSARGNRVSCMYVRCVPGARQGHQAQGGHPQLAWVGRLGDSNNPAPGGCLLGESWGTGAALACGYIHLLARYTVLFSHGNAVDLGQMSSFYIGLGSRLHCNIFSYDYSGYGASSGRPSERNLYADIDAAWQALRTRYGISPDSIILYGQSIGTVPTVDLASRYECAAVVLHSPLTSGMRVAFPDTKKTYCFDAFPNIEKVSKITSPVLIIHGTEDEVIDFSHGLALYERCPKAVEPLWVEGAGHNDIELYSQYLERLRRFISQELPSQRA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ABHD17A abhydrolase domain containing 17A [ Homo sapiens (human) ]
• Official Symbol: ABHD17A
• Synonyms: FAM108A1; family with sequence similarity 108, member A1; C19orf27, chromosome 19 open reading frame 27; abhydrolase domain-containing protein FAM108A1; MGC5244; C19orf27; ABHD17A; abhydrolase domain containing 17A
• Gene ID: 81926
• mRNA Refseq: NM_001130111
• Protein Refseq: NP_001123583
• UniProt ID: Q96GS6