Recombinant Human ABHD6 Protein, GST-Tagged
Cat.No. : | ABHD6-082H |
Product Overview : | Human ABHD6 full-length ORF ( AAH01698.1, 1 a.a. - 337 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | ABHD6 (Abhydrolase Domain Containing 6) is a Protein Coding gene. Among its related pathways are Signaling by GPCR and triacylglycerol degradation. GO annotations related to this gene include acylglycerol lipase activity. |
Molecular Mass : | 64.7 kDa |
AA Sequence : | MDLDVVNMFVIAGGTLAIPILAFVASFLLWPSALIRIYYWYWRRTLGMQVRYVHHEDYQFCYSFRGRPGHKPSILMLHGFSAHKDMWLSVVKFLPKNLHLVCVDMPGHEGTTRSSLDDLSIDGQVKRIHQFVECLKLNKKPFHLVGTSMGGQVAGVYAAYYPSDVSSLCLVCPAGLQYSTDNQFVQRLKELQGSAAVEKIPLIPSTPEEMSEMLQLCSYVRFKVPQQILQGLVDVRIPHNNFYRKLFLEIVSEKSRYSLHQNMDKIKVPTQIIWGKQDQVLDVSGADMLAKSIANCQVELLENCGHSVVMERPRKTAKLIIDFLASVHNTDNNKKLD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ABHD6 abhydrolase domain containing 6 [ Homo sapiens ] |
Official Symbol | ABHD6 |
Synonyms | Abhydrolase Domain Containing 6; EC 3.1.1.23; Abhydrolase Domain-Containing Protein 6; 2-Arachidonoylglycerol Hydrolase |
Gene ID | 57406 |
mRNA Refseq | NM_020676 |
Protein Refseq | NP_065727 |
MIM | 616966 |
UniProt ID | Q9BV23 |
◆ Recombinant Proteins | ||
ABHD6-475HFL | Recombinant Full Length Human ABHD6 Protein, C-Flag-tagged | +Inquiry |
ABHD6-6843H | Recombinant Human ABHD6 protein, His-tagged | +Inquiry |
Abhd6-1473M | Recombinant Mouse Abhd6 Protein, Myc/DDK-tagged | +Inquiry |
ABHD6-14H | Recombinant Human ABHD6 Protein, His-tagged | +Inquiry |
ABHD6-1135M | Recombinant Mouse ABHD6 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ABHD6-9131HCL | Recombinant Human ABHD6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABHD6 Products
Required fields are marked with *
My Review for All ABHD6 Products
Required fields are marked with *
0
Inquiry Basket