Recombinant Human ABHD6 Protein, GST-Tagged
| Cat.No. : | ABHD6-082H |
| Product Overview : | Human ABHD6 full-length ORF ( AAH01698.1, 1 a.a. - 337 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | ABHD6 (Abhydrolase Domain Containing 6) is a Protein Coding gene. Among its related pathways are Signaling by GPCR and triacylglycerol degradation. GO annotations related to this gene include acylglycerol lipase activity. |
| Molecular Mass : | 64.7 kDa |
| AA Sequence : | MDLDVVNMFVIAGGTLAIPILAFVASFLLWPSALIRIYYWYWRRTLGMQVRYVHHEDYQFCYSFRGRPGHKPSILMLHGFSAHKDMWLSVVKFLPKNLHLVCVDMPGHEGTTRSSLDDLSIDGQVKRIHQFVECLKLNKKPFHLVGTSMGGQVAGVYAAYYPSDVSSLCLVCPAGLQYSTDNQFVQRLKELQGSAAVEKIPLIPSTPEEMSEMLQLCSYVRFKVPQQILQGLVDVRIPHNNFYRKLFLEIVSEKSRYSLHQNMDKIKVPTQIIWGKQDQVLDVSGADMLAKSIANCQVELLENCGHSVVMERPRKTAKLIIDFLASVHNTDNNKKLD |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | ABHD6 abhydrolase domain containing 6 [ Homo sapiens ] |
| Official Symbol | ABHD6 |
| Synonyms | Abhydrolase Domain Containing 6; EC 3.1.1.23; Abhydrolase Domain-Containing Protein 6; 2-Arachidonoylglycerol Hydrolase |
| Gene ID | 57406 |
| mRNA Refseq | NM_020676 |
| Protein Refseq | NP_065727 |
| MIM | 616966 |
| UniProt ID | Q9BV23 |
| ◆ Recombinant Proteins | ||
| ABHD6-3560H | Recombinant Human ABHD6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ABHD6-193R | Recombinant Rhesus monkey ABHD6 Protein, His-tagged | +Inquiry |
| ABHD6-218M | Recombinant Mouse ABHD6 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ABHD6-79R | Recombinant Rat ABHD6 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ABHD6-6843H | Recombinant Human ABHD6 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ABHD6-9131HCL | Recombinant Human ABHD6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABHD6 Products
Required fields are marked with *
My Review for All ABHD6 Products
Required fields are marked with *
