Recombinant Human ABHD6 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | ABHD6-3560H |
Product Overview : | ABHD6 MS Standard C13 and N15-labeled recombinant protein (NP_065727) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Lipase that preferentially hydrolysis medium-chain saturated monoacylglycerols including 2-arachidonoylglycerol. Through 2-arachidonoylglycerol degradation may regulate endocannabinoid signaling pathways (By similarity). Also has a lysophosphatidyl lipase activity with a preference for lysophosphatidylglycerol among other lysophospholipids (By similarity). Also able to degrade bis(monoacylglycero)phosphate (BMP) and constitutes the major enzyme for BMP catabolism. BMP, also known as lysobisphosphatidic acid, is enriched in late endosomes and lysosomes and plays a key role in the formation of intraluminal vesicles and in lipid sorting. |
Molecular Mass : | 38.3 kDa |
AA Sequence : | MDLDVVNMFVIAGGTLAIPILAFVASFLLWPSALIRIYYWYWRRTLGMQVRYVHHEDYQFCYSFRGRPGHKPSILMLHGFSAHKDMWLSVVKFLPKNLHLVCVDMPGHEGTTRSSLDDLSIDGQVKRIHQFVECLKLNKKPFHLVGTSMGGQVAGVYAAYYPSDVSSLCLVCPAGLQYSTDNQFVQRLKELQGSAAVEKIPLIPSTPEEMSEMLQLCSYVRFKVPQQILQGLVDVRIPHNNFYRKLFLEIVSEKSRYSLHQNMDKIKVPTQIIWGKQDQVLDVSGADMLAKSIANCQVELLENCGHSVVMERPRKTAKLIIDFLASVHNTDNNKKLDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | ABHD6 abhydrolase domain containing 6 [ Homo sapiens (human) ] |
Official Symbol | ABHD6 |
Synonyms | ABHD6; abhydrolase domain containing 6, acylglycerol lipase; monoacylglycerol lipase ABHD6; 2-arachidonoylglycerol hydrolase; abhydrolase domain-containing protein 6; lipase protein; EC 3.1.1.23 |
Gene ID | 57406 |
mRNA Refseq | NM_020676 |
Protein Refseq | NP_065727 |
MIM | 616966 |
UniProt ID | Q9BV23 |
◆ Recombinant Proteins | ||
ABHD6-475HFL | Recombinant Full Length Human ABHD6 Protein, C-Flag-tagged | +Inquiry |
ABHD6-3560H | Recombinant Human ABHD6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ABHD6-880HF | Recombinant Full Length Human ABHD6 Protein, GST-tagged | +Inquiry |
Abhd6-1473M | Recombinant Mouse Abhd6 Protein, Myc/DDK-tagged | +Inquiry |
ABHD6-424R | Recombinant Rat ABHD6 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ABHD6-9131HCL | Recombinant Human ABHD6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ABHD6 Products
Required fields are marked with *
My Review for All ABHD6 Products
Required fields are marked with *
0
Inquiry Basket