Recombinant Human ACAA1 protein, GST-tagged
| Cat.No. : | ACAA1-3733H |
| Product Overview : | Recombinant Human ACAA1 protein(117-424 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 117-424 aa |
| Tag : | N-GST |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | STVNRQCSSGLQAVASIAGGIRNGSYDIGMACGVESMSLADRGNPGNITSRLMEKEKARDCLIPMGITSENVAERFGISREKQDTFALASQQKAARAQSKGCFQAEIVPVTTTVHDDKGTKRSITVTQDEGIRPSTTMEGLAKLKPAFKKDGSTTAGNSSQVSDGAAAILLARRSKAEELGLPILGVLRSYAVVGVPPDIMGIGPAYAIPVALQKAGLTVSDVDIFEINEAFASQAAYCVEKLRLPPEKVNPLGGAVALGHPLGCTGARQVITLLNELKRRGKRAYGVVSMCIGTGMGAAAVFEYPGN |
| Gene Name | ACAA1 acetyl-CoA acyltransferase 1 [ Homo sapiens ] |
| Official Symbol | ACAA1 |
| Synonyms | ACAA1; acetyl-CoA acyltransferase 1; acetyl Coenzyme A acyltransferase 1; 3-ketoacyl-CoA thiolase, peroxisomal; peroxisomal 3 oxoacyl Coenzyme A thiolase; beta-ketothiolase; peroxisomal 3-oxoacyl-CoA thiolase; acetyl-Coenzyme A acyltransferase 1; peroxisomal 3-oxoacyl-Coenzyme A thiolase; ACAA; THIO; PTHIO; |
| Gene ID | 30 |
| mRNA Refseq | NM_001130410 |
| Protein Refseq | NP_001123882 |
| MIM | 604054 |
| UniProt ID | P09110 |
| ◆ Recombinant Proteins | ||
| ACAA1-251H | Recombinant Human ACAA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ACAA1-784H | Recombinant Human Acetyl-CoA Acyltransferase 1, His-tagged | +Inquiry |
| ACAA1-1167HFL | Recombinant Full Length Human ACAA1 Protein, C-Flag-tagged | +Inquiry |
| ACAA1-0465H | Recombinant Human ACAA1 Protein (Gly182-Asn424), N-His-tagged | +Inquiry |
| ACAA1-26046TH | Recombinant Human ACAA1, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ACAA1-9119HCL | Recombinant Human ACAA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACAA1 Products
Required fields are marked with *
My Review for All ACAA1 Products
Required fields are marked with *



