Recombinant Human ACBD7 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | ACBD7-6168H |
| Product Overview : | ACBD7 MS Standard C13 and N15-labeled recombinant protein (NP_001034933) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | Binds medium- and long-chain acyl-CoA esters. |
| Molecular Mass : | 9.8 kDa |
| AA Sequence : | MALQADFDRAAEDVRKLKARPDDGELKELYGLYKQAIVGDINIACPGMLDLKGKAKWEAWNLKKGLSTEDATSAYISKAKELIEKYGITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | ACBD7 acyl-CoA binding domain containing 7 [ Homo sapiens (human) ] |
| Official Symbol | ACBD7 |
| Synonyms | ACBD7; acyl-CoA binding domain containing 7; acyl Coenzyme A binding domain containing 7; acyl-CoA-binding domain-containing protein 7; bA455B2.2; FLJ38219; acyl-Coenzyme A binding domain containing 7; FLJ52263; MGC33893; |
| Gene ID | 414149 |
| mRNA Refseq | NM_001039844 |
| Protein Refseq | NP_001034933 |
| UniProt ID | Q8N6N7 |
| ◆ Recombinant Proteins | ||
| ACBD7-7030Z | Recombinant Zebrafish ACBD7 | +Inquiry |
| ACBD7-534H | Recombinant Human ACBD7, His tagged | +Inquiry |
| ACBD7-2154H | Recombinant Human ACBD7 protein, His-tagged | +Inquiry |
| ACBD7-6168H | Recombinant Human ACBD7 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| ACBD7-32R | Recombinant Rhesus Macaque ACBD7 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ACBD7-9104HCL | Recombinant Human ACBD7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACBD7 Products
Required fields are marked with *
My Review for All ACBD7 Products
Required fields are marked with *
