Recombinant Human ACBD7 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : ACBD7-6168H
Product Overview : ACBD7 MS Standard C13 and N15-labeled recombinant protein (NP_001034933) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Binds medium- and long-chain acyl-CoA esters.
Molecular Mass : 9.8 kDa
AA Sequence : MALQADFDRAAEDVRKLKARPDDGELKELYGLYKQAIVGDINIACPGMLDLKGKAKWEAWNLKKGLSTEDATSAYISKAKELIEKYGITRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name ACBD7 acyl-CoA binding domain containing 7 [ Homo sapiens (human) ]
Official Symbol ACBD7
Synonyms ACBD7; acyl-CoA binding domain containing 7; acyl Coenzyme A binding domain containing 7; acyl-CoA-binding domain-containing protein 7; bA455B2.2; FLJ38219; acyl-Coenzyme A binding domain containing 7; FLJ52263; MGC33893;
Gene ID 414149
mRNA Refseq NM_001039844
Protein Refseq NP_001034933
UniProt ID Q8N6N7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ACBD7 Products

Required fields are marked with *

My Review for All ACBD7 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon