Recombinant Human ACO2 Protein, His-tagged
Cat.No. : | ACO2-095H |
Product Overview : | Recombinant Human ACO2 Protien(NP_001089)(1-300 aa), fused to His tag, was expressed in E. coli. |
Availability | September 15, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-300 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | MAPYSLLVTRLQKALGVRQYHVASVLCQRAKVAMSHFEPNEYIHYDLLEKNINIVRKRLNRPLTLSEKIVYGHLDDPASQEIERGKSYLRLRPDRVAMQDATAQMAMLQFISSGLSKVAVPSTIHCDHLIEAQVGGEKDLRRAKDINQEVYNFLATAGAKYGVGFWKPGSGIIHQIILENYAYPGVLLIGTDSHTPNGGGLGGICIGVGGADAVDVMAGIPWELKCPKVIGVKLTGSLSGWSSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYN |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used). Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution. |
Gene Name | ACO2 aconitase 2, mitochondrial [ Homo sapiens ] |
Official Symbol | ACO2 |
Synonyms | ACO2; aconitase 2, mitochondrial; aconitate hydratase, mitochondrial; ACONM; citrate hydro-lyase; ICRD; MGC20605; MGC33908; |
Gene ID | 50 |
mRNA Refseq | NM_001098 |
Protein Refseq | NP_001089 |
MIM | 100850 |
UniProt ID | Q99798 |
◆ Recombinant Proteins | ||
ACO2-210R | Recombinant Rhesus monkey ACO2 Protein, His-tagged | +Inquiry |
ACO2-950M | Recombinant Mouse ACO2 Protein, GST & His-tagged | +Inquiry |
ACO2-9295H | Recombinant Human ACO2 protein, GST-tagged | +Inquiry |
ACO2-783HF | Recombinant Full Length Human ACO2 Protein, GST-tagged | +Inquiry |
ACO2-9868Z | Recombinant Zebrafish ACO2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACO2-498HCL | Recombinant Human ACO2 cell lysate | +Inquiry |
ACO2-440MCL | Recombinant Mouse ACO2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACO2 Products
Required fields are marked with *
My Review for All ACO2 Products
Required fields are marked with *