Recombinant Human ACO2 protein, GST-tagged
| Cat.No. : | ACO2-9295H |
| Product Overview : | Recombinant Human ACO2 protein(1-300 aa), fused with N-terminal GST tag, was expressed in E. coli. |
| Availability | December 15, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-300 aa |
| Tag : | N-GST |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | MAPYSLLVTRLQKALGVRQYHVASVLCQRAKVAMSHFEPNEYIHYDLLEKNINIVRKRLNRPLTLSEKIVYGHLDDPASQEIERGKSYLRLRPDRVAMQDATAQMAMLQFISSGLSKVAVPSTIHCDHLIEAQVGGEKDLRRAKDINQEVYNFLATAGAKYGVGFWKPGSGIIHQIILENYAYPGVLLIGTDSHTPNGGGLGGICIGVGGADAVDVMAGIPWELKCPKVIGVKLTGSLSGWSSPKDVILKVAGILTVKGGTGAIVEYHGPGVDSISCTGMATICNMGAEIGATTSVFPYN |
| Gene Name | ACO2 aconitase 2, mitochondrial [ Homo sapiens ] |
| Official Symbol | ACO2 |
| Synonyms | ACO2; aconitase 2, mitochondrial; aconitate hydratase, mitochondrial; ACONM; citrate hydro-lyase; ICRD; MGC20605; MGC33908; |
| Gene ID | 50 |
| mRNA Refseq | NM_001098 |
| Protein Refseq | NP_001089 |
| MIM | 100850 |
| UniProt ID | Q99798 |
| ◆ Recombinant Proteins | ||
| ACO2-455R | Recombinant Rat ACO2 Protein | +Inquiry |
| ACO2-2490H | Recombinant Human ACO2 protein(Gln28-Gln780), His&GST-tagged | +Inquiry |
| ACO2-165H | Recombinant Human ACO2 Protein, GST-Tagged | +Inquiry |
| ACO2-9295H | Recombinant Human ACO2 protein, GST-tagged | +Inquiry |
| ACO2-5762C | Recombinant Chicken ACO2 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ACO2-320HKCL | Human ACO2 Knockdown Cell Lysate | +Inquiry |
| ACO2-498HCL | Recombinant Human ACO2 cell lysate | +Inquiry |
| ACO2-440MCL | Recombinant Mouse ACO2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ACO2 Products
Required fields are marked with *
My Review for All ACO2 Products
Required fields are marked with *
