Recombinant Human ACSL4 Protein, GST-tagged
Cat.No. : | ACSL4-199H |
Product Overview : | Human ACSL4 partial ORF ( NP_004449.1, 581 a.a. - 670 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is an isozyme of the long-chain fatty-acid-coenzyme A ligase family. Although differing in substrate specificity, subcellular localization, and tissue distribution, all isozymes of this family convert free long-chain fatty acids into fatty acyl-CoA esters, and thereby play a key role in lipid biosynthesis and fatty acid degradation. This isozyme preferentially utilizes arachidonate as substrate. The absence of this enzyme may contribute to the mental retardation or Alport syndrome. Alternative splicing of this gene generates multiple transcript variants. [provided by RefSeq, Jan 2016] |
Molecular Mass : | 35.64 kDa |
AA Sequence : | RLTLLAQQKGVEGTWVDICNNPAMEAEILKEIREAANAMKLERFEIPIKVRLSPEPWTPETGLVTDAFKLKRKELRNHYLKDIERMYGGK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ACSL4 acyl-CoA synthetase long-chain family member 4 [ Homo sapiens ] |
Official Symbol | ACSL4 |
Synonyms | ACSL4; acyl-CoA synthetase long-chain family member 4; FACL4, fatty acid Coenzyme A ligase, long chain 4 , mental retardation, X linked 63 , mental retardation, X linked 68 , MRX63, MRX68; long-chain-fatty-acid--CoA ligase 4; long chain fatty acid Coenzyme A ligase 4; ACS4; LACS4; lignoceroyl CoA synthase; LACS 4; acyl-CoA synthetase 4; lignoceroyl-CoA synthase; long-chain acyl-CoA synthetase 4; long-chain fatty-acid-Coenzyme A ligase 4; fatty-acid-Coenzyme A ligase, long-chain 4; FACL4; MRX63; MRX68; |
Gene ID | 2182 |
mRNA Refseq | NM_004458 |
Protein Refseq | NP_004449 |
MIM | 300157 |
UniProt ID | O60488 |
◆ Recombinant Proteins | ||
ACSL4-46R | Recombinant Rhesus Macaque ACSL4 Protein, His (Fc)-Avi-tagged | +Inquiry |
ACSL4-218R | Recombinant Rhesus monkey ACSL4 Protein, His-tagged | +Inquiry |
ACSL4-199H | Recombinant Human ACSL4 Protein, GST-tagged | +Inquiry |
Acsl4-56R | Recombinant Rat Acsl4 Protein, His-tagged | +Inquiry |
RFL-6383HF | Recombinant Full Length Human Long-Chain-Fatty-Acid--Coa Ligase 4(Acsl4) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACSL4-9074HCL | Recombinant Human ACSL4 293 Cell Lysate | +Inquiry |
ACSL4-9075HCL | Recombinant Human ACSL4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ACSL4 Products
Required fields are marked with *
My Review for All ACSL4 Products
Required fields are marked with *
0
Inquiry Basket