Recombinant Human ADIPOQ Protein

Cat.No. : ADIPOQ-03H
Product Overview : Recombinant human ADIPOQ (15-244, 231aa) without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Protein Length : 15-244
Description : This gene is expressed in adipose tissue exclusively. It encodes a protein with similarity to collagens X and VIII and complement factor C1q. The encoded protein circulates in the plasma and is involved with metabolic and hormonal processes. Mutations in this gene are associated with adiponectin deficiency. Multiple alternatively spliced variants, encoding the same protein, have been identified.
Form : Liquid
Molecular Mass : 25.1 kDa
AA Sequence : MGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIGPKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDTN
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 90% by SDS-PAGE
Applications : SDS-PAGE
Storage : Can be stored at 2 to 8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 0.5 mg/mL (determined by Bradford assay)
Storage Buffer : Phosphate-Buffered Saline (pH 7.4) containing 1 mM DTT.
Gene Name ADIPOQ adiponectin, C1Q and collagen domain containing [ Homo sapiens (human) ]
Official Symbol ADIPOQ
Synonyms ADIPOQ; adiponectin, C1Q and collagen domain containing; ACDC; ADPN; APM1; APM-1; GBP28; ACRP30; ADIPQTL1; adiponectin; 30 kDa adipocyte complement-related protein; adipocyte complement-related 30 kDa protein; adipose most abundant gene transcript 1 protein; adipose specific collagen-like factor; gelatin-binding protein 28
Gene ID 9370
mRNA Refseq NM_004797
Protein Refseq NP_004788
MIM 605441
UniProt ID Q15848

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ADIPOQ Products

Required fields are marked with *

My Review for All ADIPOQ Products

Required fields are marked with *

0
cart-icon
0
compare icon