Recombinant Human AES Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : AES-1497H
Product Overview : AES MS Standard C13 and N15-labeled recombinant protein (NP_001121) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene is similar in sequence to the amino terminus of Drosophila enhancer of split groucho, a protein involved in neurogenesis during embryonic development. The encoded protein, which belongs to the groucho/TLE family of proteins, can function as a homooligomer or as a heteroologimer with other family members to dominantly repress the expression of other family member genes. Three transcript variants encoding different isoforms have been found for this gene.
Molecular Mass : 21.8 kDa
AA Sequence : MMFPQSRHSGSSHLPQQLKFTTSDSCDRIKDEFQLLQAQYHSLKLECDKLASEKSEMQRHYVMYYEMSYGLNIEMHKQAEIVKRLNGICAQVLPYLSQEHQQQVLGAIERAKQVTAPELNSIIRQQLQAHQLSQLQALALPLTPLPVGLQPPSLPAVSAGTGLLSLSALGSQAHLSKEDKNGHDGDTHQEDDGEKSDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name AES amino-terminal enhancer of split [ Homo sapiens (human) ]
Official Symbol AES
Synonyms AES; amino-terminal enhancer of split; GRG5; TLE5; gp130-associated protein GAM; GRG; ESP1; AES-1; AES-2;
Gene ID 166
mRNA Refseq NM_001130
Protein Refseq NP_001121
MIM 600188
UniProt ID Q08117

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AES Products

Required fields are marked with *

My Review for All AES Products

Required fields are marked with *

0
cart-icon
0
compare icon