Recombinant Human AES Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | AES-1497H | 
| Product Overview : | AES MS Standard C13 and N15-labeled recombinant protein (NP_001121) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | HEK293 | 
| Tag : | DDK&Myc | 
| Description : | The protein encoded by this gene is similar in sequence to the amino terminus of Drosophila enhancer of split groucho, a protein involved in neurogenesis during embryonic development. The encoded protein, which belongs to the groucho/TLE family of proteins, can function as a homooligomer or as a heteroologimer with other family members to dominantly repress the expression of other family member genes. Three transcript variants encoding different isoforms have been found for this gene. | 
| Molecular Mass : | 21.8 kDa | 
| AA Sequence : | MMFPQSRHSGSSHLPQQLKFTTSDSCDRIKDEFQLLQAQYHSLKLECDKLASEKSEMQRHYVMYYEMSYGLNIEMHKQAEIVKRLNGICAQVLPYLSQEHQQQVLGAIERAKQVTAPELNSIIRQQLQAHQLSQLQALALPLTPLPVGLQPPSLPAVSAGTGLLSLSALGSQAHLSKEDKNGHDGDTHQEDDGEKSDTRTRPLEQKLISEEDLAANDILDYKDDDDKV | 
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. | 
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. | 
| Concentration : | 50 μg/mL as determined by BCA | 
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. | 
| Gene Name | AES amino-terminal enhancer of split [ Homo sapiens (human) ] | 
| Official Symbol | AES | 
| Synonyms | AES; amino-terminal enhancer of split; GRG5; TLE5; gp130-associated protein GAM; GRG; ESP1; AES-1; AES-2; | 
| Gene ID | 166 | 
| mRNA Refseq | NM_001130 | 
| Protein Refseq | NP_001121 | 
| MIM | 600188 | 
| UniProt ID | Q08117 | 
| ◆ Recombinant Proteins | ||
| AES-552R | Recombinant Rat AES Protein | +Inquiry | 
| AES-373M | Recombinant Mouse AES Protein, His (Fc)-Avi-tagged | +Inquiry | 
| AES-1497H | Recombinant Human AES Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry | 
| AES-28533TH | Recombinant Human AES, His-tagged | +Inquiry | 
| AES-282C | Recombinant Cynomolgus AES Protein, His-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| AES-8991HCL | Recombinant Human AES 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All AES Products
Required fields are marked with *
My Review for All AES Products
Required fields are marked with *
  
        
    
      
            