Recombinant Human AGTRAP protein, GST-tagged
Cat.No. : | AGTRAP-16H |
Product Overview : | Recombinant Human AGTRAP(1 a.a. - 152 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Protein Length : | 1 a.a. - 152 a.a. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 43.1 kDa |
AA Sequence : | MELPAVNLKVILLGHWLLTTWGCIVFSGSYAWANFTILALGVWAVAQRDSIDAISMFLGGLLATIFLDIVHISIF YPRVSLTDTGRFGVGMAILSLLLKPLSCCFVYHMYRERGGFLGSSQDRSAYQTIDSAEAPADPFAVPEGRSQDAR GY |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | AGTRAP angiotensin II receptor-associated protein [ Homo sapiens ] |
Official Symbol | AGTRAP |
Synonyms | AGTRAP; angiotensin II receptor-associated protein; type-1 angiotensin II receptor-associated protein; ATRAP; AT1 receptor-associated protein; ATI receptor-associated protein; angiotensin II, type I receptor-associated protein; MGC29646; |
Gene ID | 57085 |
mRNA Refseq | NM_001040194 |
Protein Refseq | NP_001035284 |
MIM | 608729 |
UniProt ID | Q6RW13 |
Chromosome Location | 1p36.22 |
Function | angiotensin type II receptor activity; protein binding; |
◆ Recombinant Proteins | ||
AGTRAP-9486H | Recombinant Human AGTRAP, GST-tagged | +Inquiry |
AGTRAP-2441H | Recombinant Human AGTRAP Full Length Transmembrane protein, His-SUMO & Myc-tagged | +Inquiry |
AGTRAP-568R | Recombinant Rat AGTRAP Protein | +Inquiry |
Agtrap-98M | Recombinant Mouse Agtrap Protein, His&GST-tagged | +Inquiry |
AGTRAP-7915Z | Recombinant Zebrafish AGTRAP | +Inquiry |
◆ Cell & Tissue Lysates | ||
AGTRAP-8968HCL | Recombinant Human AGTRAP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AGTRAP Products
Required fields are marked with *
My Review for All AGTRAP Products
Required fields are marked with *
0
Inquiry Basket