Recombinant Human AGTRAP protein, GST-tagged

Cat.No. : AGTRAP-16H
Product Overview : Recombinant Human AGTRAP(1 a.a. - 152 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Protein Length : 1 a.a. - 152 a.a.
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 43.1 kDa
AA Sequence : MELPAVNLKVILLGHWLLTTWGCIVFSGSYAWANFTILALGVWAVAQRDSIDAISMFLGGLLATIFLDIVHISIF YPRVSLTDTGRFGVGMAILSLLLKPLSCCFVYHMYRERGGFLGSSQDRSAYQTIDSAEAPADPFAVPEGRSQDAR GY
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name AGTRAP angiotensin II receptor-associated protein [ Homo sapiens ]
Official Symbol AGTRAP
Synonyms AGTRAP; angiotensin II receptor-associated protein; type-1 angiotensin II receptor-associated protein; ATRAP; AT1 receptor-associated protein; ATI receptor-associated protein; angiotensin II, type I receptor-associated protein; MGC29646;
Gene ID 57085
mRNA Refseq NM_001040194
Protein Refseq NP_001035284
MIM 608729
UniProt ID Q6RW13
Chromosome Location 1p36.22
Function angiotensin type II receptor activity; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AGTRAP Products

Required fields are marked with *

My Review for All AGTRAP Products

Required fields are marked with *

0

Inquiry Basket

cartIcon