Recombinant Human AGTRAP protein, GST-tagged
| Cat.No. : | AGTRAP-16H |
| Product Overview : | Recombinant Human AGTRAP(1 a.a. - 152 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Protein Length : | 1 a.a. - 152 a.a. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 43.1 kDa |
| AA Sequence : | MELPAVNLKVILLGHWLLTTWGCIVFSGSYAWANFTILALGVWAVAQRDSIDAISMFLGGLLATIFLDIVHISIF YPRVSLTDTGRFGVGMAILSLLLKPLSCCFVYHMYRERGGFLGSSQDRSAYQTIDSAEAPADPFAVPEGRSQDAR GY |
| Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Gene Name | AGTRAP angiotensin II receptor-associated protein [ Homo sapiens ] |
| Official Symbol | AGTRAP |
| Synonyms | AGTRAP; angiotensin II receptor-associated protein; type-1 angiotensin II receptor-associated protein; ATRAP; AT1 receptor-associated protein; ATI receptor-associated protein; angiotensin II, type I receptor-associated protein; MGC29646; |
| Gene ID | 57085 |
| mRNA Refseq | NM_001040194 |
| Protein Refseq | NP_001035284 |
| MIM | 608729 |
| UniProt ID | Q6RW13 |
| Chromosome Location | 1p36.22 |
| Function | angiotensin type II receptor activity; protein binding; |
| ◆ Cell & Tissue Lysates | ||
| AGTRAP-8968HCL | Recombinant Human AGTRAP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AGTRAP Products
Required fields are marked with *
My Review for All AGTRAP Products
Required fields are marked with *
