Recombinant Human APLNR Protein, GST-tagged
| Cat.No. : | AGTRAP-448H |
| Product Overview : | Human AGTRAP partial ORF ( NP_065083, 108 a.a. - 159 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a transmembrane protein localized to the plasma membrane and perinuclear vesicular structures. The gene product interacts with the angiotensin II type I receptor and negatively regulates angiotensin II signaling. Alternative splicing of this gene generates multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 31.46 kDa |
| AA Sequence : | HMYRERGGELLVHTGFLGSSQDRSAYQTIDSAEAPADPFAVPEGRSQDARGS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | AGTRAP angiotensin II receptor-associated protein [ Homo sapiens ] |
| Official Symbol | AGTRAP |
| Synonyms | AGTRAP; angiotensin II receptor-associated protein; type-1 angiotensin II receptor-associated protein; ATRAP; AT1 receptor-associated protein; ATI receptor-associated protein; angiotensin II, type I receptor-associated protein; MGC29646; |
| Gene ID | 57085 |
| mRNA Refseq | NM_001040194 |
| Protein Refseq | NP_001035284 |
| MIM | 608729 |
| UniProt ID | Q6RW13 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AGTRAP Products
Required fields are marked with *
My Review for All AGTRAP Products
Required fields are marked with *
