"AGTRAP" Related Products

Expand
Expand

Recombinant Human AGTRAP protein, GST-tagged

Cat.No.: AGTRAP-17H
Product Overview: Recombinant Human AGTRAP(108 a.a. - 159 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Source: Wheat Germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 31.46 kDa
Protein length: 108 a.a. - 159 a.a.
AA Sequence: HMYRERGGELLVHTGFLGSSQDRSAYQTIDSAEAPADPFAVPEGRSQDARGS
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: AGTRAP angiotensin II receptor-associated protein [ Homo sapiens ]
Official Symbol: AGTRAP
Synonyms: AGTRAP; angiotensin II receptor-associated protein; type-1 angiotensin II receptor-associated protein; ATRAP; AT1 receptor-associated protein; ATI receptor-associated protein; angiotensin II, type I receptor-associated protein; MGC29646;
Gene ID: 57085
mRNA Refseq: NM_020350
Protein Refseq: NP_065083
MIM: 608729
UniProt ID: Q6RW13
Chromosome Location: 1p36.22
Function: angiotensin type II receptor activity; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.