Recombinant Human AIPL1 Protein, GST-tagged

Cat.No. : AIPL1-481H
Product Overview : Human AIPL1 partial ORF ( NP_055151.3, 1 a.a. - 101 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Leber congenital amaurosis (LCA) is the most severe inherited retinopathy with the earliest age of onset and accounts for at least 5% of all inherited retinal diseases. Affected individuals are diagnosed at birth or in the first few months of life with nystagmus, severely impaired vision or blindness and an abnormal or flat electroretinogram. The photoreceptor/pineal-expressed gene, AIPL1, encoding aryl-hydrocarbon interacting protein-like 1, is located within the LCA4 candidate region. The encoded protein contains three tetratricopeptide motifs, consistent with chaperone or nuclear transport activity. Mutations in this gene may cause approximately 20% of recessive LCA. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014]
Molecular Mass : 36.85 kDa
AA Sequence : MDAALLLNVEGVKKTILHGGTGELPNFITGSRVIFHFRTMKCDEERTVIDDSRQVGQPMHIIIGNMFKLEVWEILLTSMRVHEVAEFWCDTIHTGVYPILS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name AIPL1 aryl hydrocarbon receptor interacting protein-like 1 [ Homo sapiens ]
Official Symbol AIPL1
Synonyms AIPL1; aryl hydrocarbon receptor interacting protein-like 1; aryl hydrocarbon receptor interacting protein like 1, LCA4; aryl-hydrocarbon-interacting protein-like 1; LCA4; AIPL2;
Gene ID 23746
mRNA Refseq NM_001033054
Protein Refseq NP_001028226
MIM 604392
UniProt ID Q9NZN9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AIPL1 Products

Required fields are marked with *

My Review for All AIPL1 Products

Required fields are marked with *

0
cart-icon