Recombinant Human AK3 protein, GST-tagged
Cat.No. : | AK3-301589H |
Product Overview : | Recombinant Human AK3 (1-227 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Pro227 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MGASARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGTEIGVLAKAFIDQGKLIPDDVMTRLALHELKNLTQYSWLLDGFPRTLPQAEALDRAYQIDTVINLNVPFEVIKQRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEDQTKPVLEYYQKKGVLETFSGTETNKIWPYVYAFLQTKVPQRSQKASVTP |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | AK3 adenylate kinase 3 [ Homo sapiens ] |
Official Symbol | AK3 |
Synonyms | AK3; adenylate kinase 3; adenylate kinase 3 like 1 , adenylate kinase 6 , AK3L1, AK6; GTP:AMP phosphotransferase, mitochondrial; AKL3L1; adenylate kinase 3 alpha-like 1; adenylate kinase 6, adenylate kinase 3 like 1; AK6; FIX; AK3L1; AKL3L; |
Gene ID | 50808 |
mRNA Refseq | NM_001199852 |
Protein Refseq | NP_001186781 |
MIM | 609290 |
UniProt ID | Q9UIJ7 |
◆ Recombinant Proteins | ||
AK3-422M | Recombinant Mouse AK3 Protein, His (Fc)-Avi-tagged | +Inquiry |
AK3-284R | Recombinant Rhesus monkey AK3 Protein, His-tagged | +Inquiry |
AK3-1464M | Recombinant Mouse AK3 Protein | +Inquiry |
Ak3-1576M | Recombinant Mouse Ak3 Protein, Myc/DDK-tagged | +Inquiry |
AK3-3921H | Recombinant Human AK3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
AK3-8947HCL | Recombinant Human AK3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AK3 Products
Required fields are marked with *
My Review for All AK3 Products
Required fields are marked with *