Recombinant Human AK3 protein, His-tagged

Cat.No. : AK3-9513H
Product Overview : Recombinant Human AK3 protein(1-227 aa), fused with N-terminal His tag, was expressed in E. coli.
Availability September 19, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Source : E.coli
Tag : His
Protein Length : 1-227 aa
Tag : N-His
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
AA Sequence : MGASARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGTEIGVLAKAFIDQGKLIPDDVMTRLALHELKNLTQYSWLLDGFPRTLPQAEALDRAYQIDTVINLNVPFEVIKQRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEDQTKPVLEYYQKKGVLETFSGTETNKIWPYVYAFLQTKVPQRSQKASVTP
Gene Name AK3 adenylate kinase 3 [ Homo sapiens ]
Official Symbol AK3
Synonyms AK3; adenylate kinase 3; adenylate kinase 3 like 1 , adenylate kinase 6 , AK3L1, AK6; GTP:AMP phosphotransferase, mitochondrial; AKL3L1; adenylate kinase 3 alpha-like 1; adenylate kinase 6, adenylate kinase 3 like 1; AK6; FIX; AK3L1; AKL3L;
Gene ID 50808
mRNA Refseq NM_001199852
Protein Refseq NP_001186781
MIM 609290
UniProt ID Q9UIJ7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AK3 Products

Required fields are marked with *

My Review for All AK3 Products

Required fields are marked with *

0
cart-icon
0
compare icon