Recombinant Human AK3 protein, His-tagged
| Cat.No. : | AK3-9513H |
| Product Overview : | Recombinant Human AK3 protein(1-227 aa), fused with N-terminal His tag, was expressed in E. coli. |
| Availability | May 24, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-227 aa |
| Tag : | N-His |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | MGASARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGTEIGVLAKAFIDQGKLIPDDVMTRLALHELKNLTQYSWLLDGFPRTLPQAEALDRAYQIDTVINLNVPFEVIKQRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEDQTKPVLEYYQKKGVLETFSGTETNKIWPYVYAFLQTKVPQRSQKASVTP |
| Gene Name | AK3 adenylate kinase 3 [ Homo sapiens ] |
| Official Symbol | AK3 |
| Synonyms | AK3; adenylate kinase 3; adenylate kinase 3 like 1 , adenylate kinase 6 , AK3L1, AK6; GTP:AMP phosphotransferase, mitochondrial; AKL3L1; adenylate kinase 3 alpha-like 1; adenylate kinase 6, adenylate kinase 3 like 1; AK6; FIX; AK3L1; AKL3L; |
| Gene ID | 50808 |
| mRNA Refseq | NM_001199852 |
| Protein Refseq | NP_001186781 |
| MIM | 609290 |
| UniProt ID | Q9UIJ7 |
| ◆ Recombinant Proteins | ||
| AK3-4891H | Recombinant Human AK3 protein, His&Myc-tagged | +Inquiry |
| AK3-301589H | Recombinant Human AK3 protein, GST-tagged | +Inquiry |
| AK3-926H | Recombinant Human AK3 | +Inquiry |
| AK3-284R | Recombinant Rhesus monkey AK3 Protein, His-tagged | +Inquiry |
| AK3-964HF | Recombinant Full Length Human AK3 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AK3-8947HCL | Recombinant Human AK3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AK3 Products
Required fields are marked with *
My Review for All AK3 Products
Required fields are marked with *
