Recombinant Human AKAP12 protein(421-530 aa), C-His-tagged

Cat.No. : AKAP12-2822H
Product Overview : Recombinant Human AKAP12 protein(Q02952)(421-530 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 421-530 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : VSTVEERTEEQKTEVEETAGSVPAEELVEMDAEPQEAEPAKELVKLKETCVSGEDPTQGADLSPDEKVLSKPPEGVVSEVEMLSSQERMKVQGSPLKKLFTSTGLKKLSG
Gene Name AKAP12 A kinase (PRKA) anchor protein 12 [ Homo sapiens ]
Official Symbol AKAP12
Synonyms AKAP12; A kinase (PRKA) anchor protein 12; A kinase (PRKA) anchor protein (gravin) 12; A-kinase anchor protein 12; AKAP250; gravin; Src Suppressed C Kinase Substrate; SSeCKS; AKAP 250; kinase scaffold protein gravin; A-kinase anchor protein, 250kDa; Src-Suppressed C Kinase Substrate; myasthenia gravis autoantigen gravin; FLJ20945; FLJ97621; DKFZp686M0430; DKFZp686O0331;
Gene ID 9590
mRNA Refseq NM_005100
Protein Refseq NP_005091
MIM 604698
UniProt ID Q02952

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AKAP12 Products

Required fields are marked with *

My Review for All AKAP12 Products

Required fields are marked with *

0
cart-icon