Recombinant Human AKAP12 protein(421-530 aa), C-His-tagged
Cat.No. : | AKAP12-2822H |
Product Overview : | Recombinant Human AKAP12 protein(Q02952)(421-530 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 421-530 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | VSTVEERTEEQKTEVEETAGSVPAEELVEMDAEPQEAEPAKELVKLKETCVSGEDPTQGADLSPDEKVLSKPPEGVVSEVEMLSSQERMKVQGSPLKKLFTSTGLKKLSG |
Gene Name | AKAP12 A kinase (PRKA) anchor protein 12 [ Homo sapiens ] |
Official Symbol | AKAP12 |
Synonyms | AKAP12; A kinase (PRKA) anchor protein 12; A kinase (PRKA) anchor protein (gravin) 12; A-kinase anchor protein 12; AKAP250; gravin; Src Suppressed C Kinase Substrate; SSeCKS; AKAP 250; kinase scaffold protein gravin; A-kinase anchor protein, 250kDa; Src-Suppressed C Kinase Substrate; myasthenia gravis autoantigen gravin; FLJ20945; FLJ97621; DKFZp686M0430; DKFZp686O0331; |
Gene ID | 9590 |
mRNA Refseq | NM_005100 |
Protein Refseq | NP_005091 |
MIM | 604698 |
UniProt ID | Q02952 |
◆ Recombinant Proteins | ||
AKAP12-8983H | Recombinant Human AKAP12 protein, His-tagged | +Inquiry |
AKAP12-588R | Recombinant Rat AKAP12 Protein | +Inquiry |
AKAP12-287R | Recombinant Rhesus monkey AKAP12 Protein, His-tagged | +Inquiry |
AKAP12-115R | Recombinant Rhesus Macaque AKAP12 Protein, His (Fc)-Avi-tagged | +Inquiry |
AKAP12-2822H | Recombinant Human AKAP12 protein(421-530 aa), C-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
AKAP12-8941HCL | Recombinant Human AKAP12 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AKAP12 Products
Required fields are marked with *
My Review for All AKAP12 Products
Required fields are marked with *
0
Inquiry Basket