Recombinant Human AKIRIN2 Protein, GST-Tagged
| Cat.No. : | AKIRIN2-0011H |
| Product Overview : | Human C6orf166 full-length ORF (AAH00764, 1 a.a. - 203 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | AKIRIN2 (Akirin 2) is a Protein Coding gene. GO annotations related to this gene include enzyme binding. An important paralog of this gene is AKIRIN1. |
| Molecular Mass : | 48.07 kDa |
| AA Sequence : | MACGATLKRTLDFDPLLSPASPKRRRCAPLSAPTSAAASPLSAAAATAASFSAAAASPQKYLRMEPSPFGDVSSRLTTEQILYNIKQEYKRMQKRRHLETSFQQTDPCCTSDAQPHAFLLSGPASPGTSSAASSPLKKEQPLFTLRQVGMICERLLKEREEKVREEYEEILNTKLAEQYDAFVKFTHDQIMRRYGEQPASYVS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | AKIRIN2 akirin 2 [ Homo sapiens ] |
| Official Symbol | AKIRIN2 |
| Synonyms | AKIRIN2; akirin 2; C6orf166, chromosome 6 open reading frame 166; akirin-2; dJ486L4.2; FLJ10342; fourteen-three-three beta interactant 1; FBI1; C6orf166; |
| Gene ID | 55122 |
| mRNA Refseq | NM_018064 |
| Protein Refseq | NP_060534 |
| MIM | 615165 |
| UniProt ID | Q53H80 |
| ◆ Recombinant Proteins | ||
| AKIRIN2-525HFL | Recombinant Full Length Human AKIRIN2 Protein, C-Flag-tagged | +Inquiry |
| AKIRIN2-250R | Recombinant Rat AKIRIN2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| AKIRIN2-2584HF | Recombinant Full Length Human AKIRIN2 Protein, GST-tagged | +Inquiry |
| AKIRIN2-2312H | Recombinant Human AKIRIN2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| AKIRIN2-4119C | Recombinant Chicken AKIRIN2 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| AKIRIN2-8934HCL | Recombinant Human AKIRIN2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All AKIRIN2 Products
Required fields are marked with *
My Review for All AKIRIN2 Products
Required fields are marked with *



