Recombinant Human AKIRIN2 Protein, GST-Tagged

Cat.No. : AKIRIN2-0011H
Product Overview : Human C6orf166 full-length ORF (AAH00764, 1 a.a. - 203 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : AKIRIN2 (Akirin 2) is a Protein Coding gene. GO annotations related to this gene include enzyme binding. An important paralog of this gene is AKIRIN1.
Molecular Mass : 48.07 kDa
AA Sequence : MACGATLKRTLDFDPLLSPASPKRRRCAPLSAPTSAAASPLSAAAATAASFSAAAASPQKYLRMEPSPFGDVSSRLTTEQILYNIKQEYKRMQKRRHLETSFQQTDPCCTSDAQPHAFLLSGPASPGTSSAASSPLKKEQPLFTLRQVGMICERLLKEREEKVREEYEEILNTKLAEQYDAFVKFTHDQIMRRYGEQPASYVS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name AKIRIN2 akirin 2 [ Homo sapiens ]
Official Symbol AKIRIN2
Synonyms AKIRIN2; akirin 2; C6orf166, chromosome 6 open reading frame 166; akirin-2; dJ486L4.2; FLJ10342; fourteen-three-three beta interactant 1; FBI1; C6orf166;
Gene ID 55122
mRNA Refseq NM_018064
Protein Refseq NP_060534
MIM 615165
UniProt ID Q53H80

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AKIRIN2 Products

Required fields are marked with *

My Review for All AKIRIN2 Products

Required fields are marked with *

0
cart-icon