Recombinant Human AKT1 protein, His-tagged
Cat.No. : | AKT1-2689H |
Product Overview : | Recombinant Human AKT1 protein(293-405 aa), fused with N-terminal His tag, was expressed in E. coli. |
Availability | May 01, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 293-405 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | FGLCKEGIKDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQH |
Gene Name | AKT1 v-akt murine thymoma viral oncogene homolog 1 [ Homo sapiens ] |
Official Symbol | AKT1 |
Synonyms | AKT1; v-akt murine thymoma viral oncogene homolog 1; RAC-alpha serine/threonine-protein kinase; AKT; PKB; PRKBA; RAC; PKB alpha; RAC-PK-alpha; proto-oncogene c-Akt; protein kinase B alpha; rac protein kinase alpha; PKB-ALPHA; RAC-ALPHA; MGC99656; |
Gene ID | 207 |
mRNA Refseq | NM_001014431 |
Protein Refseq | NP_001014431 |
MIM | 164730 |
UniProt ID | P31749 |
◆ Recombinant Proteins | ||
AKT1-2689H | Recombinant Human AKT1 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ACF1 Products
Required fields are marked with *
My Review for All ACF1 Products
Required fields are marked with *
0
Inquiry Basket