Recombinant Human ALKAL1 Protein (28-129 aa), His-B2M-tagged

• Cat.No.: ALKAL1-2012H
• Product Overview: Recombinant Human ALKAL1 Protein (28-129 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-B2M tag at the N-terminal. Protein Description: Full Length of Mature Protein.

Specification

• Species: Human
• Source: E.coli
• Tag: B2M&His
• Protein Length: 28-129 aa
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 25.5 kDa
• AA Sequence: RPRGRRGARVTDKEPKPLLFLPAAGAGRTPSGSRSAEIFPRDSNLKDKFIKHFTGPVTFSPECSKHFHRLYYNTRECSTPAYYKRCARLLTRLAVSPLCSQT
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: ALKAL1 ALK and LTK ligand 1 [ Homo sapiens (human) ]
• Official Symbol: ALKAL1
• Synonyms: AUGA; AUGB; FAM150A; UNQ9433
• Gene ID: 389658
• mRNA Refseq: NM_207413
• Protein Refseq: NP_997296
• UniProt ID: Q6UXT8