Recombinant Human ALKAL1 Protein (28-129 aa), His-B2M-tagged

Cat.No. : ALKAL1-2012H
Product Overview : Recombinant Human ALKAL1 Protein (28-129 aa) is produced by E. coli expression system. This protein is fused with a 6xHis-B2M tag at the N-terminal. Protein Description: Full Length of Mature Protein.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : B2M&His
Protein Length : 28-129 aa
Form : Tris-based buffer,50% glycerol
Molecular Mass : 25.5 kDa
AA Sequence : RPRGRRGARVTDKEPKPLLFLPAAGAGRTPSGSRSAEIFPRDSNLKDKFIKHFTGPVTFSPECSKHFHRLYYNTRECSTPAYYKRCARLLTRLAVSPLCSQT
Purity : > 90% as determined by SDS-PAGE.
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration : A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name ALKAL1 ALK and LTK ligand 1 [ Homo sapiens (human) ]
Official Symbol ALKAL1
Synonyms AUGA; AUGB; FAM150A; UNQ9433;
Gene ID 389658
mRNA Refseq NM_207413
Protein Refseq NP_997296
UniProt ID Q6UXT8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ALKAL1 Products

Required fields are marked with *

My Review for All ALKAL1 Products

Required fields are marked with *

0
cart-icon
0
compare icon