Recombinant Human ALKBH6 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : ALKBH6-2492H
Product Overview : ALKBH6 MS Standard C13 and N15-labeled recombinant protein (NP_942567) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Probable dioxygenase that requires molecular oxygen, alpha-ketoglutarate and iron.
Molecular Mass : 17.8 kDa
AA Sequence : MAGRGMGMLNLEIGGDAGGRIGCKELVLMEEQDARVPALEPFRVEQAPPVIYYVPDFISKEEEEYLLRQVFNAPKPKWTQLSGRKLQNWGGLPHPRGMVPERLPPWLQRYVDKVSNLSLFGGLPANHVLVNQYLPGEGIMHHQPGLPHRAGLLRAAAARGRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name ALKBH6 alkB homolog 6 [ Homo sapiens (human) ]
Official Symbol ALKBH6
Synonyms alkB, alkylation repair homolog 6 (E. coli); alkylation repair homolog 6; probable alpha-ketoglutarate-dependent dioxygenase ABH6; Alkylated DNA repair protein alkB homolog 6; EC 1.14.11.; MGC15677; ALKBH6
Gene ID 84964
mRNA Refseq NM_198867
Protein Refseq NP_942567
MIM 613304
UniProt ID Q3KRA9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ALKBH6 Products

Required fields are marked with *

My Review for All ALKBH6 Products

Required fields are marked with *

0
cart-icon