Recombinant Human ALKBH6 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | ALKBH6-2492H |
| Product Overview : | ALKBH6 MS Standard C13 and N15-labeled recombinant protein (NP_942567) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | Probable dioxygenase that requires molecular oxygen, alpha-ketoglutarate and iron. |
| Molecular Mass : | 17.8 kDa |
| AA Sequence : | MAGRGMGMLNLEIGGDAGGRIGCKELVLMEEQDARVPALEPFRVEQAPPVIYYVPDFISKEEEEYLLRQVFNAPKPKWTQLSGRKLQNWGGLPHPRGMVPERLPPWLQRYVDKVSNLSLFGGLPANHVLVNQYLPGEGIMHHQPGLPHRAGLLRAAAARGRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | ALKBH6 alkB homolog 6 [ Homo sapiens (human) ] |
| Official Symbol | ALKBH6 |
| Synonyms | alkB, alkylation repair homolog 6 (E. coli); alkylation repair homolog 6; probable alpha-ketoglutarate-dependent dioxygenase ABH6; Alkylated DNA repair protein alkB homolog 6; EC 1.14.11.; MGC15677; ALKBH6 |
| Gene ID | 84964 |
| mRNA Refseq | NM_198867 |
| Protein Refseq | NP_942567 |
| MIM | 613304 |
| UniProt ID | Q3KRA9 |
| ◆ Recombinant Proteins | ||
| ALKBH6-9587H | Recombinant Human ALKBH6, GST-tagged | +Inquiry |
| ALKBH6-1403Z | Recombinant Zebrafish ALKBH6 | +Inquiry |
| Alkbh6-1601M | Recombinant Mouse Alkbh6 Protein, Myc/DDK-tagged | +Inquiry |
| ALKBH6-2492H | Recombinant Human ALKBH6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ALKBH6 Products
Required fields are marked with *
My Review for All ALKBH6 Products
Required fields are marked with *
