Recombinant Human Alpha-Synuclein Protein, 15N Label
| Cat.No. : | ASN-308H |
| Product Overview : | Recombinant Human Alpha-Synuclein Protein, 15N Uniform Label is expressed in Escherichia coli in minimal media using 15NH4Cl as sole nitrogen source. Counter Ion: Ammonium Carbonate. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | Non |
| Form : | Lyophilized, Alpha-Synuclein is readily soluble in PBS. |
| AA Sequence : | MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA |
| Purity : | > 95% HPLC and SDS-PAGE |
| Storage : | Store at -20 centigrade upon arrival. |
| ◆ Recombinant Proteins | ||
| ASN-308H | Recombinant Human Alpha-Synuclein Protein, 15N Label | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ASN Products
Required fields are marked with *
My Review for All ASN Products
Required fields are marked with *
Recently Viewed
