Recombinant Human ANGPTL8 protein
Cat.No. : | ANGPTL8-190H |
Product Overview : | Recombinant human Betatrophin cDNA ( 177aa ) was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, Sucrose and DTT. |
AA Sequence : | MTLHRNEYGIASILDSYQCTAEISLADLATIFFAQFVQEATYKEVSKMVKDALTAIEKPTGDEQSSGCLENQLPA FLEELCHEKEILEKYGHSDCCSQSEEGRHNCFLAHKKPTPASIPLFQVPEPVTSCEAYEEDRETFMNKFIYEIAR RHPFLYAPTILLWAARYDKIIPSCCKAENAVECFQTKAATVTKELRESSGGSHHHHHHGSENLYFQGAPMGGPEL AQHEELTLLFHGTLQLGQALNGVYRTTEGRLTKARNSLGLYGRTIELLGQEVSRGRDAAQELRASLLETQMEEDI LQLQAEATAEVLGEVAQAQKVLRDSVQRLEVQLRSAWLGPAYREFEVLKAHADKQSHILWALTGHVQRQRREMVA QQHRLRQIQERLHTAALPA |
Purity : | >90% by SDS-PAGE |
Applications : | 1. May be used for in vitro human Betatrophin signaling pathway regulation study for human pancreatic beta cell differentiation.2. As antigen for specific antibody production. |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Publications : |
Recombinant betatrophin (Angptl‑8/lipasin) ameliorates streptozotocin‑induced hyperglycemia and β‑cell destruction in neonatal rats (2019)
|
Gene Name | ANGPTL8 angiopoietin like 8 [ Homo sapiens ] |
Official Symbol | ANGPTL8 |
Synonyms | RIFL; TD26; PRO1185; PVPA599; C19orf80; angiopoietin-like 8; betatrophin variant 1; betatrophin variant 2; hepatocellular carcinoma-associated gene TD26; hepatocellular carcinoma-associated protein TD26; lipasin; refeeding-induced fat and liver protein |
Gene ID | 55908 |
mRNA Refseq | NM_018687 |
Protein Refseq | NP_061157 |
MIM | 616223 |
UniProt ID | Q6UXH0 |
Chromosome Location | 19p13.2 |
Function | hormone activity; hormone activity; protein binding |
◆ Recombinant Proteins | ||
Angptl8-2333M | Recombinant Mouse Angptl8 protein, His-tagged | +Inquiry |
Angptl8-5916M | Recombinant Mouse Angptl8 protein, His-tagged | +Inquiry |
ANGPTL8-3898H | Recombinant Human ANGPTL8 protein, His-tagged | +Inquiry |
ANGPTL8-1699M | Recombinant Mouse ANGPTL8 Protein (16-198 aa), His-tagged | +Inquiry |
ANGPTL8-190H | Recombinant Human ANGPTL8 protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANGPTL8 Products
Required fields are marked with *
My Review for All ANGPTL8 Products
Required fields are marked with *