Recombinant Human ANGPTL8 protein, His-tagged
Cat.No. : | ANGPTL8-2322H |
Product Overview : | Recombinant Human ANGPTL8 protein(Q6UXH0)(22-198aa), fused to N-terminal His tag, was expressed in Insect Cell. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Insect Cells |
Tag : | His |
Protein Length : | 22-198aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 22.4 kDa |
AA Sequence : | APMGGPELAQHEELTLLFHGTLQLGQALNGVYRTTEGRLTKARNSLGLYGRTIELLGQEVSRGRDAAQELRASLLETQMEEDILQLQAEATAEVLGEVAQAQKVLRDSVQRLEVQLRSAWLGPAYREFEVLKAHADKQSHILWALTGHVQRQRREMVAQQHRLRQIQERLHTAALPA |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
◆ Recombinant Proteins | ||
Angptl8-2333M | Recombinant Mouse Angptl8 protein, His-tagged | +Inquiry |
ANGPTL8-190H | Recombinant Human ANGPTL8 protein | +Inquiry |
ANGPTL8-01H | Active Recombinant Human ANGPTL8 Protein, His-tagged | +Inquiry |
ANGPTL8-2078H | Recombinant Human ANGPTL8 Protein, His-tagged | +Inquiry |
Angptl8-315M | Recombinant Mouse Angptl8 Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANGPTL8 Products
Required fields are marked with *
My Review for All ANGPTL8 Products
Required fields are marked with *