Recombinant Human ANKMY1 protein, His-tagged
Cat.No. : | ANKMY1-9660H |
Product Overview : | Recombinant Human ANKMY1 protein(302-579 aa), fused with N-terminal His tag, was expressed in E.coli. |
Availability | July 12, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 302-579 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | GHVESGLEDVLGNTDRGSLCSAETKFESNVCVCDFSIELSQAMLERSAQSHSLLKMASPSPCTSSFDKGTMRRMALSMIERRKRWRTIKLLLRRGADPNLCCVPMQVLFLAVKAGDVDGVRLLLEHGARTDICFPPQC |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | ANKMY1 ankyrin repeat and MYND domain containing 1 [ Homo sapiens ] |
Official Symbol | ANKMY1 |
Synonyms | ANKMY1; ankyrin repeat and MYND domain containing 1; ankyrin repeat and MYND domain-containing protein 1; FLJ20499; ZMYND13; testis specific ankyrin-like protein 1; testis-specific ankyrin-like protein 1; zinc finger MYND domain-containing protein 13; DKFZp686D20155; DKFZp686L21237; |
Gene ID | 51281 |
mRNA Refseq | NM_016552 |
Protein Refseq | NP_057636 |
UniProt ID | Q9P2S6 |
◆ Recombinant Proteins | ||
ANKMY1-567H | Recombinant Human ANKMY1 protein, GST-tagged | +Inquiry |
ANKMY1-9660H | Recombinant Human ANKMY1 protein, His-tagged | +Inquiry |
ANKMY1-1278HF | Recombinant Full Length Human ANKMY1 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ANKMY1-78HCL | Recombinant Human ANKMY1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ANKMY1 Products
Required fields are marked with *
My Review for All ANKMY1 Products
Required fields are marked with *