Recombinant Human ANKMY1 protein, His-tagged

Cat.No. : ANKMY1-9660H
Product Overview : Recombinant Human ANKMY1 protein(302-579 aa), fused with N-terminal His tag, was expressed in E.coli.
Availability July 12, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 302-579 aa
Form : The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole.
AASequence : GHVESGLEDVLGNTDRGSLCSAETKFESNVCVCDFSIELSQAMLERSAQSHSLLKMASPSPCTSSFDKGTMRRMALSMIERRKRWRTIKLLLRRGADPNLCCVPMQVLFLAVKAGDVDGVRLLLEHGARTDICFPPQC
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution.
Gene Name ANKMY1 ankyrin repeat and MYND domain containing 1 [ Homo sapiens ]
Official Symbol ANKMY1
Synonyms ANKMY1; ankyrin repeat and MYND domain containing 1; ankyrin repeat and MYND domain-containing protein 1; FLJ20499; ZMYND13; testis specific ankyrin-like protein 1; testis-specific ankyrin-like protein 1; zinc finger MYND domain-containing protein 13; DKFZp686D20155; DKFZp686L21237;
Gene ID 51281
mRNA Refseq NM_016552
Protein Refseq NP_057636
UniProt ID Q9P2S6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ANKMY1 Products

Required fields are marked with *

My Review for All ANKMY1 Products

Required fields are marked with *

0
cart-icon