Recombinant Human ANKRD13D protein, GST-tagged

• Cat.No.: ANKRD13D-575H
• Product Overview: Human ANKRD13D full-length ORF ( AAH44239.1, 1 a.a. - 255 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is a member of the ankyrin repeat domain (ANKRD) 13 family, which currently consists of four proteins containing ubiquitin-interacting motifs. These proteins are integral membrane proteins that bind specifically to Lys-63-linked ubiquitin chains on membrane-bound proteins, targeting those proteins for rapid internalization. [provided by RefSeq, Dec 2016]
• Molecular Mass: 54.8 kDa
• AA Sequence: MSCGRLGRFKATLWLSEEHPLSLGDQVTPIIDLMAISNAHFAKLRDFITLRLPPGFPVKIEIPLFHVLNARITFSNLCGCDEPLSSVWVPAPSSAVAASGNPFPCEVDPTVFEVPNGYSVLGMERNEPLRDEDDDLLQFAIQQSLLEAGTEAEQVTVWEALTNTRPGARPPPQATVYEEQLQLERALQESLQLSTEPRGPGSPPRTPPAPGPPSFEEQLRLALELSSREQEERERRGQQEEEDLQRILQLSLTEH
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ANKRD13D ankyrin repeat domain 13 family, member D [ Homo sapiens ]
• Official Symbol: ANKRD13D
• Synonyms: ANKRD13D; ankyrin repeat domain 13 family, member D; ankyrin repeat domain-containing protein 13D; MGC50828
• Gene ID: 338692
• mRNA Refseq: NM_207354
• Protein Refseq: NP_997237
• MIM: 615126
• UniProt ID: Q6ZTN6