Recombinant Human ANKRD13D protein, GST-tagged

Cat.No. : ANKRD13D-575H
Product Overview : Human ANKRD13D full-length ORF ( AAH44239.1, 1 a.a. - 255 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : The protein encoded by this gene is a member of the ankyrin repeat domain (ANKRD) 13 family, which currently consists of four proteins containing ubiquitin-interacting motifs. These proteins are integral membrane proteins that bind specifically to Lys-63-linked ubiquitin chains on membrane-bound proteins, targeting those proteins for rapid internalization. [provided by RefSeq, Dec 2016]
Molecular Mass : 54.8 kDa
AA Sequence : MSCGRLGRFKATLWLSEEHPLSLGDQVTPIIDLMAISNAHFAKLRDFITLRLPPGFPVKIEIPLFHVLNARITFSNLCGCDEPLSSVWVPAPSSAVAASGNPFPCEVDPTVFEVPNGYSVLGMERNEPLRDEDDDLLQFAIQQSLLEAGTEAEQVTVWEALTNTRPGARPPPQATVYEEQLQLERALQESLQLSTEPRGPGSPPRTPPAPGPPSFEEQLRLALELSSREQEERERRGQQEEEDLQRILQLSLTEH
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ANKRD13D ankyrin repeat domain 13 family, member D [ Homo sapiens ]
Official Symbol ANKRD13D
Synonyms ANKRD13D; ankyrin repeat domain 13 family, member D; ankyrin repeat domain-containing protein 13D; MGC50828;
Gene ID 338692
mRNA Refseq NM_207354
Protein Refseq NP_997237
MIM 615126
UniProt ID Q6ZTN6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ANKRD13D Products

Required fields are marked with *

My Review for All ANKRD13D Products

Required fields are marked with *

0

Inquiry Basket

cartIcon