Recombinant Human APOA5 protein, His-GST&Myc-tagged
Cat.No. : | APOA5-7443H |
Product Overview : | Recombinant Human APOA5 protein(Q6Q788)(260-366aa), fused with N-terminal His and GST tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST&His&Myc |
Protein Length : | 260-366aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 47.0 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | AFAGTGTEEGAGPDPQMLSEEVRQRLQAFRQDTYLQIAAFTRAIDQETEEVQQQLAPPPPGHSAFAPEFQQTDSGKVLSKLQARLDDLWEDITHSLHDQGHSHLGDP |
Gene Name | APOA5 apolipoprotein A-V [ Homo sapiens ] |
Official Symbol | APOA5 |
Synonyms | APOA5; apolipoprotein A-V; APOA V; RAP3; apo-AV; apolipoprotein A5; regeneration-associated protein 3; APOAV; FLJ97995; MGC126836; MGC126838; |
Gene ID | 116519 |
mRNA Refseq | NM_001166598 |
Protein Refseq | NP_001160070 |
MIM | 606368 |
UniProt ID | Q6Q788 |
◆ Recombinant Proteins | ||
APOA5-629M | Recombinant Mouse APOA5 Protein, His (Fc)-Avi-tagged | +Inquiry |
APOA5-0409H | Recombinant Human APOA5 Protein (Asp167-Lys335), N-His-tagged | +Inquiry |
APOA5-210C | Recombinant Cattle APOA5 Protein, His-tagged | +Inquiry |
Apoa5-213M | Recombinant Mouse Apoa5 Protein, His-tagged | +Inquiry |
Apoa5-1662M | Recombinant Mouse Apoa5 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
APOA5-8787HCL | Recombinant Human APOA5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All APOA5 Products
Required fields are marked with *
My Review for All APOA5 Products
Required fields are marked with *