Recombinant Human APOC4 Protein (27-127 aa), His-tagged
Cat.No. : | APOC4-1334H |
Product Overview : | Recombinant Human APOC4 Protein (27-127 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Transport. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 27-127 aa |
Description : | May participate in lipoprotein metabolism. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 13.8 kDa |
AA Sequence : | CQPEAQEGTLSPPPKLKMSRWSLVRGRMKELLETVVNRTRDGWQWFWSPSTFRGFMQTYYDDHLRDLGPLTKAWFLESKDSLLKKTHSLCPRLVCGDKDQG |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
Gene Name | APOC4 apolipoprotein C-IV [ Homo sapiens ] |
Official Symbol | APOC4 |
Synonyms | APOC4; apolipoprotein C4; APO-CIV; APOC-IV; |
Gene ID | 346 |
mRNA Refseq | NM_001646 |
Protein Refseq | NP_001637 |
MIM | 600745 |
UniProt ID | P55056 |
◆ Recombinant Proteins | ||
Apoc4-1855M | Recombinant Mouse Apoc4 protein, His & GST-tagged | +Inquiry |
APOC4-3571R | Recombinant Rabbit APOC4, GST-tagged | +Inquiry |
APOC4-281H | Recombinant Human APOC4, GST-tagged | +Inquiry |
APOC4-224H | Recombinant Human APOC4 Protein, His-tagged | +Inquiry |
APOC4-380R | Recombinant Rat APOC4 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
APOC4-10HFL | Recombinant Human APOC4 Protein, GST tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
APOC4-98HCL | Recombinant Human APOC4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All APOC4 Products
Required fields are marked with *
My Review for All APOC4 Products
Required fields are marked with *
0
Inquiry Basket