Recombinant Human APOC4 Protein (27-127 aa), His-tagged
| Cat.No. : | APOC4-1334H |
| Product Overview : | Recombinant Human APOC4 Protein (27-127 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Transport. Protein Description: Full Length of Mature Protein. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 27-127 aa |
| Description : | May participate in lipoprotein metabolism. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 13.8 kDa |
| AA Sequence : | CQPEAQEGTLSPPPKLKMSRWSLVRGRMKELLETVVNRTRDGWQWFWSPSTFRGFMQTYYDDHLRDLGPLTKAWFLESKDSLLKKTHSLCPRLVCGDKDQG |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information. |
| Gene Name | APOC4 apolipoprotein C-IV [ Homo sapiens ] |
| Official Symbol | APOC4 |
| Synonyms | APOC4; apolipoprotein C4; APO-CIV; APOC-IV; |
| Gene ID | 346 |
| mRNA Refseq | NM_001646 |
| Protein Refseq | NP_001637 |
| MIM | 600745 |
| UniProt ID | P55056 |
| ◆ Recombinant Proteins | ||
| APOC4-224H | Recombinant Human APOC4 Protein, His-tagged | +Inquiry |
| APOC4-380R | Recombinant Rat APOC4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| APOC4-9761H | Recombinant Human APOC4, GST-tagged | +Inquiry |
| Apoc4-1855M | Recombinant Mouse Apoc4 protein, His & GST-tagged | +Inquiry |
| APOC4-636M | Recombinant Mouse APOC4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| APOC4-98HCL | Recombinant Human APOC4 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All APOC4 Products
Required fields are marked with *
My Review for All APOC4 Products
Required fields are marked with *
