Recombinant Human APOC4 Protein (27-127 aa), His-tagged

• Cat.No.: APOC4-1334H
• Product Overview: Recombinant Human APOC4 Protein (27-127 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Transport. Protein Description: Full Length of Mature Protein.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 27-127 aa
• Description: May participate in lipoprotein metabolism.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 13.8 kDa
• AA Sequence: CQPEAQEGTLSPPPKLKMSRWSLVRGRMKELLETVVNRTRDGWQWFWSPSTFRGFMQTYYDDHLRDLGPLTKAWFLESKDSLLKKTHSLCPRLVCGDKDQG
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products. Please refer to it for detailed information.

Gene Information

• Gene Name: APOC4 apolipoprotein C-IV [ Homo sapiens ]
• Official Symbol: APOC4
• Synonyms: APOC4; apolipoprotein C4; APO-CIV; APOC-IV
• Gene ID: 346
• mRNA Refseq: NM_001646
• Protein Refseq: NP_001637
• MIM: 600745
• UniProt ID: P55056