Recombinant Human AQP4 protein, His-tagged

Cat.No. : AQP4-9731H
Product Overview : Recombinant Human AQP4(253-323aa) fused with His tag at N-terminal was expressed in Yeast.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Yeast
Tag : His
Protein Length : 253-323aa
Description : This gene encodes a member of the aquaporin family of intrinsic membrane proteins that function as water-selective channels in the plasma membranes of many cells. The encoded protein is the predominant aquaporin found in brain. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Molecular Mass : 23.98kD
AA Sequence : CPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV
Storage : If store at 2-8 centigrade, no more than 1 month; If store at -80 centigrade, no more than 12 month. Avoid multiple freeze-thaw cycles.
Gene Name AQP4 aquaporin 4 [ Homo sapiens ]
Official Symbol AQP4
Synonyms AQP4; aquaporin 4; aquaporin-4; MIWC; WCH4; aquaporin type4; mercurial-insensitive water channel; HMIWC2; MGC22454;
Gene ID 361
mRNA Refseq NM_001650
Protein Refseq NP_001641
MIM 600308
UniProt ID P55087
Chromosome Location 18q11.2-q12.1
Pathway Aquaporin-mediated transport, organism-specific biosystem; Bile secretion, organism-specific biosystem; Bile secretion, conserved biosystem; Passive Transport by Aquaporins, organism-specific biosystem; Regulation of Water Balance by Renal Aquaporins, organism-specific biosystem; Transmembrane transport of small molecules, organism-specific biosystem; Vasopressin-regulated water reabsorption, organism-specific biosystem;
Function transporter activity; water channel activity; water transmembrane transporter activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All AQP4 Products

Required fields are marked with *

My Review for All AQP4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon