"AQP4" Related Products

Expand
Expand

Recombinant Human AQP4 protein, His-tagged

Cat.No.: AQP4-9731H
Product Overview: Recombinant Human AQP4(253-323aa) fused with His tag at N-terminal was expressed in Yeast.
Description: This gene encodes a member of the aquaporin family of intrinsic membrane proteins that function as water-selective channels in the plasma membranes of many cells. The encoded protein is the predominant aquaporin found in brain. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.
Source: Yeast
Species: Human
Tag: His
Molecular Mass: 23.98kD
Protein length: 253-323aa
AA Sequence: CPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV
Storage: If store at 2-8 centigrade, no more than 1 month; If store at -80 centigrade, no more than 12 month. Avoid multiple freeze-thaw cycles.
Gene Name: AQP4 aquaporin 4 [ Homo sapiens ]
Official Symbol: AQP4
Synonyms: AQP4; aquaporin 4; aquaporin-4; MIWC; WCH4; aquaporin type4; mercurial-insensitive water channel; HMIWC2; MGC22454;
Gene ID: 361
mRNA Refseq: NM_001650
Protein Refseq: NP_001641
MIM: 600308
UniProt ID: P55087
Chromosome Location: 18q11.2-q12.1
Pathway: Aquaporin-mediated transport, organism-specific biosystem; Bile secretion, organism-specific biosystem; Bile secretion, conserved biosystem; Passive Transport by Aquaporins, organism-specific biosystem; Regulation of Water Balance by Renal Aquaporins, organism-specific biosystem; Transmembrane transport of small molecules, organism-specific biosystem; Vasopressin-regulated water reabsorption, organism-specific biosystem;
Function: transporter activity; water channel activity; water transmembrane transporter activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.