Recombinant Human AQP4 protein, His-tagged
Cat.No. : | AQP4-9731H |
Product Overview : | Recombinant Human AQP4(253-323aa) fused with His tag at N-terminal was expressed in Yeast. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 253-323aa |
Description : | This gene encodes a member of the aquaporin family of intrinsic membrane proteins that function as water-selective channels in the plasma membranes of many cells. The encoded protein is the predominant aquaporin found in brain. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. |
Molecular Mass : | 23.98kD |
AA Sequence : | CPDVEFKRRFKEAFSKAAQQTKGSYMEVEDNRSQVETDDLILKPGVVHVIDVDRGEEKKGKDQSGEVLSSV |
Storage : | If store at 2-8 centigrade, no more than 1 month; If store at -80 centigrade, no more than 12 month. Avoid multiple freeze-thaw cycles. |
Gene Name | AQP4 aquaporin 4 [ Homo sapiens ] |
Official Symbol | AQP4 |
Synonyms | AQP4; aquaporin 4; aquaporin-4; MIWC; WCH4; aquaporin type4; mercurial-insensitive water channel; HMIWC2; MGC22454; |
Gene ID | 361 |
mRNA Refseq | NM_001650 |
Protein Refseq | NP_001641 |
MIM | 600308 |
UniProt ID | P55087 |
Chromosome Location | 18q11.2-q12.1 |
Pathway | Aquaporin-mediated transport, organism-specific biosystem; Bile secretion, organism-specific biosystem; Bile secretion, conserved biosystem; Passive Transport by Aquaporins, organism-specific biosystem; Regulation of Water Balance by Renal Aquaporins, organism-specific biosystem; Transmembrane transport of small molecules, organism-specific biosystem; Vasopressin-regulated water reabsorption, organism-specific biosystem; |
Function | transporter activity; water channel activity; water transmembrane transporter activity; |
◆ Recombinant Proteins | ||
AQP4-734H | Recombinant Human AQP4 protein, GST-tagged | +Inquiry |
AQP4-2226M | Recombinant Mouse AQP4 Protein (253-323 aa), His-tagged | +Inquiry |
AQP4-374R | Recombinant Rhesus monkey AQP4 Protein, His-tagged | +Inquiry |
AQP4-738R | Recombinant Rat AQP4 Protein | +Inquiry |
Aqp4-1048M | Recombinant Mouse Aqp4 Full Length Transmembrane protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
AQP4-32HCL | Recombinant Human AQP4 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All AQP4 Products
Required fields are marked with *
My Review for All AQP4 Products
Required fields are marked with *
0
Inquiry Basket