Recombinant Human ARD1A protein, GST-tagged

Cat.No. : ARD1A-4633H
Product Overview : Recombinant Human ARD1A protein(1-235 aa), fused with N-terminal GST tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-235 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
AA Sequence : MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKMEEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALHLYSNTLNFQISEVEPKYYADGEDAYAMKRDLTQMADELRRHLELKEKGRHVVLGAIENKVESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSAS
Purity : 80%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Official Symbol ARD1A
Synonyms NAA10; TE2; ARD1; NATD; ARD1A; DXS707; N(alpha)-acetyltransferase 10, NatA catalytic subunit; N-alpha-acetyltransferase 10; ARD1 homolog A, N-acetyltransferase; N-acetyltransferase ARD1, human homolog of; N-alpha-acetyltransferase 10, NatA catalytic subunit; N-terminal acetyltransferase complex ARD1 subunit homolog A; EC 2.3.1.88
Gene ID 8260
mRNA Refseq NM_001256119
Protein Refseq NP_001243048
MIM 300013
UniProt ID P41227

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ARD1A Products

Required fields are marked with *

My Review for All ARD1A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon