Recombinant Human ARD1A protein, GST-tagged

• Cat.No.: ARD1A-4633H
• Product Overview: Recombinant Human ARD1A protein(1-235 aa), fused with N-terminal GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-235 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• AA Sequence: MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKMEEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALHLYSNTLNFQISEVEPKYYADGEDAYAMKRDLTQMADELRRHLELKEKGRHVVLGAIENKVESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSAS
• Purity: 80%, by SDS-PAGE with Coomassie Brilliant Blue staining.

Gene Information

• Official Symbol: ARD1A
• Synonyms: NAA10; TE2; ARD1; NATD; ARD1A; DXS707; N(alpha)-acetyltransferase 10, NatA catalytic subunit; N-alpha-acetyltransferase 10; ARD1 homolog A, N-acetyltransferase; N-acetyltransferase ARD1, human homolog of; N-alpha-acetyltransferase 10, NatA catalytic subunit; N-terminal acetyltransferase complex ARD1 subunit homolog A; EC 2.3.1.88
• Gene ID: 8260
• mRNA Refseq: NM_001256119
• Protein Refseq: NP_001243048
• MIM: 300013
• UniProt ID: P41227