Recombinant Human ARFIP2, His-tagged
| Cat.No. : | ARFIP2-27057TH |
| Product Overview : | Recombinant fragment, corresponding to amino acids 1-261 of Human ARFIP2 with an N-terminal His Tag, approximately 30kDa |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-261 a.a. |
| Description : | ARFIP2 is a ubiquitously expressed protein implicated in mediating cross talk between RAC and ARF small GTPases. It has been shown that ARFIP2 binds specifically to GTP-bound ARF1 and ARF6, but binds to Rac-GTP and Rac-GDP with similar affinities. The X-ray structure of arfaptin reveals an elongated, crescent-shaped dimer of 3-helix coiled-coils. Structures of arfaptin with Rac bound to either GDP or the slowly hydrolysable analog GMPPNP show that the switch regions adopt similar conformations in both complexes. |
| Conjugation : | HIS |
| Form : | Lyophilised:reconstitution with 105 μl aqua dest. |
| Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
| Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
| Sequences of amino acids : | MTDGILGKAATMEIPIHGNGEARQLPEDDGLEQDLQQVMV SGPNLNETSIVSGGYGGSGDGLIPTGSGRHPSHSTTPS GPGDEVARGIAGEKFDIVKKWGINTYKCTKQLLSERFG RGSRTVDLELELQIELLRETKRKYESVLQLGRALTAHLYS LLQTQHALGDAFADLSQKSPELQEEFGYNAETQKLLCK NGETLLGAVNFFVSSINTLVTKTMEDTLMTVKQYEAAR LEYDAYRTDLEELSLGPRDAGTRGRLESA |
| Gene Name | ARFIP2 ADP-ribosylation factor interacting protein 2 [ Homo sapiens ] |
| Official Symbol | ARFIP2 |
| Synonyms | ARFIP2; ADP-ribosylation factor interacting protein 2; arfaptin-2; arfaptin 2; POR1; |
| Gene ID | 23647 |
| mRNA Refseq | NM_001242854 |
| Protein Refseq | NP_001229783 |
| MIM | 601638 |
| Uniprot ID | P53365 |
| Chromosome Location | 11p15 |
| Pathway | Arf1 pathway, organism-specific biosystem; |
| Function | GTP binding; GTP-dependent protein binding; GTP-dependent protein binding; Rac GTPase binding; protein binding; |
| ◆ Recombinant Proteins | ||
| ARFIP2-3036H | Recombinant Human ADP-RibosylationFactorInteracting Protein 2, T7-tagged | +Inquiry |
| Arfip2-1676M | Recombinant Mouse Arfip2 Protein, Myc/DDK-tagged | +Inquiry |
| ARFIP2-156H | Recombinant Human ARFIP2 protein, T7-tagged | +Inquiry |
| ARFIP2-1173HF | Recombinant Full Length Human ARFIP2 Protein, GST-tagged | +Inquiry |
| ARFIP2-758R | Recombinant Rat ARFIP2 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ARFIP2-8749HCL | Recombinant Human ARFIP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARFIP2 Products
Required fields are marked with *
My Review for All ARFIP2 Products
Required fields are marked with *




