Recombinant Human ARFIP2, His-tagged
Cat.No. : | ARFIP2-27057TH |
Product Overview : | Recombinant fragment, corresponding to amino acids 1-261 of Human ARFIP2 with an N-terminal His Tag, approximately 30kDa |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-261 a.a. |
Description : | ARFIP2 is a ubiquitously expressed protein implicated in mediating cross talk between RAC and ARF small GTPases. It has been shown that ARFIP2 binds specifically to GTP-bound ARF1 and ARF6, but binds to Rac-GTP and Rac-GDP with similar affinities. The X-ray structure of arfaptin reveals an elongated, crescent-shaped dimer of 3-helix coiled-coils. Structures of arfaptin with Rac bound to either GDP or the slowly hydrolysable analog GMPPNP show that the switch regions adopt similar conformations in both complexes. |
Conjugation : | HIS |
Form : | Lyophilised:reconstitution with 105 μl aqua dest. |
Storage buffer : | Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MTDGILGKAATMEIPIHGNGEARQLPEDDGLEQDLQQVMV SGPNLNETSIVSGGYGGSGDGLIPTGSGRHPSHSTTPS GPGDEVARGIAGEKFDIVKKWGINTYKCTKQLLSERFG RGSRTVDLELELQIELLRETKRKYESVLQLGRALTAHLYS LLQTQHALGDAFADLSQKSPELQEEFGYNAETQKLLCK NGETLLGAVNFFVSSINTLVTKTMEDTLMTVKQYEAAR LEYDAYRTDLEELSLGPRDAGTRGRLESA |
Gene Name | ARFIP2 ADP-ribosylation factor interacting protein 2 [ Homo sapiens ] |
Official Symbol | ARFIP2 |
Synonyms | ARFIP2; ADP-ribosylation factor interacting protein 2; arfaptin-2; arfaptin 2; POR1; |
Gene ID | 23647 |
mRNA Refseq | NM_001242854 |
Protein Refseq | NP_001229783 |
MIM | 601638 |
Uniprot ID | P53365 |
Chromosome Location | 11p15 |
Pathway | Arf1 pathway, organism-specific biosystem; |
Function | GTP binding; GTP-dependent protein binding; GTP-dependent protein binding; Rac GTPase binding; protein binding; |
◆ Recombinant Proteins | ||
ARFIP2-414R | Recombinant Rat ARFIP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
ARFIP2-27057TH | Recombinant Human ARFIP2, His-tagged | +Inquiry |
ARFIP2-1849M | Recombinant Mouse ARFIP2 Protein | +Inquiry |
ARFIP2-156H | Recombinant Human ARFIP2 protein, T7-tagged | +Inquiry |
ARFIP2-1173HF | Recombinant Full Length Human ARFIP2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARFIP2-8749HCL | Recombinant Human ARFIP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ARFIP2 Products
Required fields are marked with *
My Review for All ARFIP2 Products
Required fields are marked with *
0
Inquiry Basket