Recombinant Human ARHGEF16 protein, GST-tagged

• Cat.No.: ARHGEF16-782H
• Product Overview: Human ARHGEF16 full-length ORF ( NP_055263.1, 1 a.a. - 421 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: Although the specific function of this protein is not known yet, it is thought to be involved in protein-protein and protein-lipid interactions. [provided by RefSeq, Jul 2008]
• Molecular Mass: 75.1 kDa
• AA Sequence: MFEILTSEFSYQHSLSILVEEFLQSKELRATVTQMEHHHLFSNILDVLGASQRFFEDLEQRHKAQVLVEDISDILEEHAEKYFHPYIAYCSNEVYQQRTLQKLISSNAAFREALREIERRPACGGLPMLSFLILPMQRVTRLPLLMDTLCLKTQGHSERYKAASRALKAISKLVRQCNEGAHRMERMEQMYTLHTQLDFSKVKSLPLISASRWLLKRGELFLVEETGLFRKIASRPTCYLFLFNDVLVVTKKKSEESYMVQDYAQMNHIQVEKIEPSELPLPGGGNRSSSVPHPFQVTLLRNSEGRQEQLLLSSDSASDRARWIVALTHSERQWQGLSSKGDLPQVEITKAFFAKQADEVTLQQADVVLVLQQEDGWLYGERLRDGETGWFPEDFARFITSRVAVEGNVRRMERLRVETDV
• Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: ARHGEF16 Rho guanine nucleotide exchange factor (GEF) 16 [ Homo sapiens ]
• Official Symbol: ARHGEF16
• Synonyms: ARHGEF16; Rho guanine nucleotide exchange factor (GEF) 16; rho guanine nucleotide exchange factor 16; GEF16; NBR; putative neuroblastoma protein; ephexin-4; Rho guanine exchange factor (GEF) 16
• Gene ID: 27237
• mRNA Refseq: NM_014448
• Protein Refseq: NP_055263
• UniProt ID: Q5VV41