Recombinant Human ARHGEF16 protein, GST-tagged
Cat.No. : | ARHGEF16-782H |
Product Overview : | Human ARHGEF16 full-length ORF ( NP_055263.1, 1 a.a. - 421 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Although the specific function of this protein is not known yet, it is thought to be involved in protein-protein and protein-lipid interactions. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 75.1 kDa |
AA Sequence : | MFEILTSEFSYQHSLSILVEEFLQSKELRATVTQMEHHHLFSNILDVLGASQRFFEDLEQRHKAQVLVEDISDILEEHAEKYFHPYIAYCSNEVYQQRTLQKLISSNAAFREALREIERRPACGGLPMLSFLILPMQRVTRLPLLMDTLCLKTQGHSERYKAASRALKAISKLVRQCNEGAHRMERMEQMYTLHTQLDFSKVKSLPLISASRWLLKRGELFLVEETGLFRKIASRPTCYLFLFNDVLVVTKKKSEESYMVQDYAQMNHIQVEKIEPSELPLPGGGNRSSSVPHPFQVTLLRNSEGRQEQLLLSSDSASDRARWIVALTHSERQWQGLSSKGDLPQVEITKAFFAKQADEVTLQQADVVLVLQQEDGWLYGERLRDGETGWFPEDFARFITSRVAVEGNVRRMERLRVETDV |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ARHGEF16 Rho guanine nucleotide exchange factor (GEF) 16 [ Homo sapiens ] |
Official Symbol | ARHGEF16 |
Synonyms | ARHGEF16; Rho guanine nucleotide exchange factor (GEF) 16; rho guanine nucleotide exchange factor 16; GEF16; NBR; putative neuroblastoma protein; ephexin-4; Rho guanine exchange factor (GEF) 16; |
Gene ID | 27237 |
mRNA Refseq | NM_014448 |
Protein Refseq | NP_055263 |
UniProt ID | Q5VV41 |
◆ Recombinant Proteins | ||
ARHGEF16-782H | Recombinant Human ARHGEF16 protein, GST-tagged | +Inquiry |
ARHGEF16-2696H | Recombinant Human ARHGEF16 Protein, His-tagged | +Inquiry |
ARHGEF16-6671Z | Recombinant Zebrafish ARHGEF16 | +Inquiry |
ARHGEF16-1891M | Recombinant Mouse ARHGEF16 Protein | +Inquiry |
ARHGEF16-1226HF | Recombinant Full Length Human ARHGEF16 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ARHGEF16-117HCL | Recombinant Human ARHGEF16 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARHGEF16 Products
Required fields are marked with *
My Review for All ARHGEF16 Products
Required fields are marked with *