Recombinant Human ARID3C protein, GST-tagged
Cat.No. : | ARID3C-796H |
Product Overview : | Human ARID3C full-length ORF ( AAI48444.1, 1 a.a. - 412 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene is a member of the ARID (AT-rich interaction domain) family of proteins. The ARID domain is a helix-turn-helix motif-based DNA-binding domain. ARID family members have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptional regulation and possibly in chromatin structure modification. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 71.72 kDa |
AA Sequence : | MEALQKQQAARLAQGVGPLAPACPLLPPQPPLPDHRTLQAPEGALGNVGAEEEEDAEEDEEKREEAGAEEEAAEESRPGAQGPSSPSSQPPGLHPHEWTYEEQFKQLYELDADPKRKEFLDDLFSFMQKRGTPVNRVPIMAKQVLDLYALFRLVTAKGGLVEVINRKVWREVTRGLSLPTTITSAAFTLRTQYMKYLYPYECETRALSSPGELQAAIDSNRREGRRQAYTATPLFGLAGPPPRGAQDPALGPGPAPPATQSSPGPAQGSTSGLPAHACAQLSPSPIKKEESGIPNPCLALPVGLALGPTREKLAPEEPPEKRAVLMGPMDPPRPCMPPSFLPRGKVPLREERLDGPLNLAGSGISSINMALEINGVVYTGVLFARRQPVPASQGPTNPAPPPSTGPPSSILP |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ARID3C AT rich interactive domain 3C (BRIGHT-like) [ Homo sapiens ] |
Official Symbol | ARID3C |
Synonyms | ARID3C; AT rich interactive domain 3C (BRIGHT-like); AT rich interactive domain 3C (BRIGHT like); AT-rich interactive domain-containing protein 3C; ARID domain-containing protein 3C; |
Gene ID | 138715 |
mRNA Refseq | NM_001017363 |
Protein Refseq | NP_001017363 |
UniProt ID | A6NKF2 |
◆ Recombinant Proteins | ||
ARID3C-1352HF | Recombinant Full Length Human ARID3C Protein, GST-tagged | +Inquiry |
Arid3c-1699M | Recombinant Mouse Arid3c Protein, Myc/DDK-tagged | +Inquiry |
ARID3C-708M | Recombinant Mouse ARID3C Protein, His (Fc)-Avi-tagged | +Inquiry |
ARID3C-2692H | Recombinant Human ARID3C Protein, MYC/DDK-tagged | +Inquiry |
ARID3C-1913M | Recombinant Mouse ARID3C Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ARID3C Products
Required fields are marked with *
My Review for All ARID3C Products
Required fields are marked with *