Recombinant Human ARL6IP5 protein, His/SUMO-tagged

• Cat.No.: ARL6IP5-95H
• Product Overview: Recombinant Human ARL6IP5(1-188 aa) fused with His/SUMO tag was expressed in E.coli cell free.

Specification

• Species: Human
• Source: E.coli
• Tag: His&SUMO
• Protein Length: 1-188 aa
• Description: expression of this gene is affected by vitamin A. The encoded protein of this gene may be associated with the cytoskeleton. A similar protein in rats may play a role in the regulation of cell differentiation. The rat protein binds and inhibits the cell membrane glutamate transporter EAAC1. The expression of the rat gene is upregulated by retinoic acid, which results in a specific reduction in EAAC1-mediated glutamate transport.
• Form: Tris-based buffer, 50% glycerol
• AA Sequence: MDVNIAPLRAWDDFFPGSDRFARPDFRDISKWNNRVVSNLLYYQTNYLVVAAMMISIVGF LSPFNMILGGIVVVLVFTGFVWAAHNKDVLRRMKKRYPTTFVMVVMLASYFLISMFGGVM VFVFGITFPLLLMFIHASLRLRNLKNKLENKMEGIGLKRTPMGIVLDALEQQEEGINRLT DYISKVKE
• Storage: Store at -20 centigrade, for extended storage, conserve at -20 centigrade or -80 centigrade. Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.

Gene Information

• Gene Name: ARL6IP5 ADP-ribosylation-like factor 6 interacting protein 5 [ Homo sapiens ]
• Official Symbol: ARL6IP5
• Synonyms: ARL6IP5; ADP-ribosylation-like factor 6 interacting protein 5; PRA1 family protein 3; DERP11; GTRAP3 18; HSPC127; JWA; PRA1 domain family 3; PRAF3; JM5; aip-5; protein JWa; ARL-6-interacting protein 5; dermal papilla derived protein 11; dermal papilla-derived protein 11; prenylated Rab acceptor protein 2; putative MAPK activating protein PM27; putative MAPK-activating protein PM27; glutamate transporter EEAC1-associated protein; glutamate transporter EAAC1-interacting protein; cytoskeleton related vitamin A responsive protein; cytoskeleton-related vitamin A-responsive protein; ADP-ribosylation factor-like protein 6-interacting protein 5; jmx; hp22; addicsin; GTRAP3-18
• Gene ID: 10550
• mRNA Refseq: NM_006407
• Protein Refseq: NP_006398
• MIM: 605709
• UniProt ID: O75915
• Chromosome Location: 3p14
• Function: protein C-terminus binding