Recombinant Human ARL6IP5 protein, His/SUMO-tagged

Cat.No. : ARL6IP5-95H
Product Overview : Recombinant Human ARL6IP5(1-188 aa) fused with His/SUMO tag was expressed in E.coli cell free.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&SUMO
Protein Length : 1-188 aa
Description : expression of this gene is affected by vitamin A. The encoded protein of this gene may be associated with the cytoskeleton. A similar protein in rats may play a role in the regulation of cell differentiation. The rat protein binds and inhibits the cell membrane glutamate transporter EAAC1. The expression of the rat gene is upregulated by retinoic acid, which results in a specific reduction in EAAC1-mediated glutamate transport.
Form : Tris-based buffer, 50% glycerol
AA Sequence : MDVNIAPLRAWDDFFPGSDRFARPDFRDISKWNNRVVSNLLYYQTNYLVVAAMMISIVGF LSPFNMILGGIVVVLVFTGFVWAAHNKDVLRRMKKRYPTTFVMVVMLASYFLISMFGGVM VFVFGITFPLLLMFIHASLRLRNLKNKLENKMEGIGLKRTPMGIVLDALEQQEEGINRLT DYISKVKE
Storage : Store at -20 centigrade, for extended storage, conserve at -20 centigrade or -80 centigrade. Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Gene Name ARL6IP5 ADP-ribosylation-like factor 6 interacting protein 5 [ Homo sapiens ]
Official Symbol ARL6IP5
Synonyms ARL6IP5; ADP-ribosylation-like factor 6 interacting protein 5; PRA1 family protein 3; DERP11; GTRAP3 18; HSPC127; JWA; PRA1 domain family 3; PRAF3; JM5; aip-5; protein JWa; ARL-6-interacting protein 5; dermal papilla derived protein 11; dermal papilla-derived protein 11; prenylated Rab acceptor protein 2; putative MAPK activating protein PM27; putative MAPK-activating protein PM27; glutamate transporter EEAC1-associated protein; glutamate transporter EAAC1-interacting protein; cytoskeleton related vitamin A responsive protein; cytoskeleton-related vitamin A-responsive protein; ADP-ribosylation factor-like protein 6-interacting protein 5; jmx; hp22; addicsin; GTRAP3-18;
Gene ID 10550
mRNA Refseq NM_006407
Protein Refseq NP_006398
MIM 605709
UniProt ID O75915
Chromosome Location 3p14
Function protein C-terminus binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ARL6IP5 Products

Required fields are marked with *

My Review for All ARL6IP5 Products

Required fields are marked with *

0
cart-icon
0
compare icon