Recombinant Human ASB13 Protein, His-tagged
| Cat.No. : | ASB13-425H |
| Product Overview : | Recombinant Human ASB13, transcript variant 1, fused with His tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Description : | The protein encoded by this gene is a member of the ankyrin repeat and SOCS box-containing (ASB) family of proteins. They contain ankyrin repeat sequence and a SOCS box domain. The SOCS box serves to couple suppressor of cytokine signalling (SOCS) proteins and their binding partners with the elongin B and C complex, possibly targeting them for degradation. Multiple alternatively spliced transcript variants, both protein-coding and not protein-coding, have been described for this gene. |
| Form : | Supplied as a 0.2 µM filtered solution of PBS, pH 7.4, 4M Urea |
| Molecular Mass : | 31.4kD |
| AA Sequence : | MNHKVHHHHHHMEPRAADGCFLGDVGFWVERTPVHEAAQRGESLQLQQLIESGACVNQVTVDSITPLHAASLQGQARCVQLLLAAGAQVDARNIDGSTPLCDACASGSIECVKLLLSYGAKVNPPLYTASPLHEACMSGSSECVRLLIDVGANLEAHDCHFGTPLHVACAREHLDCVKVLLNAGANVNAAKLHETALHHAAKVKNVDLIEMLIEFGGNIYARDNRGKKPSDYTWSSSAPAKCFEYYEKTPLTLSQ |
| Endotoxin : | Endotoxin level is <0.1 ng/µg of protein (<1EU/µg). |
| Purity : | >95% as determined by SDS-PAGE and Coomassie blue staining |
| Gene Name | ASB13 ankyrin repeat and SOCS box containing 13 [ Homo sapiens ] |
| Official Symbol | ASB13 |
| Synonyms | ASB13; ankyrin repeat and SOCS box containing 13; ankyrin repeat and SOCS box protein 13; FLJ13134; MGC19879; ankyrin repeat and SOCS box-containing 13; ankyrin repeat domain-containing SOCS box protein Asb-13; |
| Gene ID | 79754 |
| mRNA Refseq | NM_024701 |
| Protein Refseq | NP_078977 |
| UniProt ID | Q8WXK3 |
| ◆ Recombinant Proteins | ||
| ASB13-425H | Recombinant Human ASB13 Protein, His-tagged | +Inquiry |
| ASB13-426H | Recombinant Human ASB13 Protein, His-tagged | +Inquiry |
| ASB13-886H | Recombinant Human ASB13 protein, GST-tagged | +Inquiry |
| ASB13-0067H | Recombinant Human ASB13 Protein (Met1-Asn278), N-His-tagged | +Inquiry |
| ASB13-4257C | Recombinant Chicken ASB13 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ASB13-8666HCL | Recombinant Human ASB13 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ASB13 Products
Required fields are marked with *
My Review for All ASB13 Products
Required fields are marked with *
