Recombinant Human ASB13 Protein, His-tagged

• Cat.No.: ASB13-425H
• Product Overview: Recombinant Human ASB13, transcript variant 1, fused with His tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: The protein encoded by this gene is a member of the ankyrin repeat and SOCS box-containing (ASB) family of proteins. They contain ankyrin repeat sequence and a SOCS box domain. The SOCS box serves to couple suppressor of cytokine signalling (SOCS) proteins and their binding partners with the elongin B and C complex, possibly targeting them for degradation. Multiple alternatively spliced transcript variants, both protein-coding and not protein-coding, have been described for this gene.
• Form: Supplied as a 0.2 µM filtered solution of PBS, pH 7.4, 4M Urea
• Molecular Mass: 31.4kD
• AA Sequence: MNHKVHHHHHHMEPRAADGCFLGDVGFWVERTPVHEAAQRGESLQLQQLIESGACVNQVTVDSITPLHAASLQGQARCVQLLLAAGAQVDARNIDGSTPLCDACASGSIECVKLLLSYGAKVNPPLYTASPLHEACMSGSSECVRLLIDVGANLEAHDCHFGTPLHVACAREHLDCVKVLLNAGANVNAAKLHETALHHAAKVKNVDLIEMLIEFGGNIYARDNRGKKPSDYTWSSSAPAKCFEYYEKTPLTLSQ
• Endotoxin: Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
• Purity: >95% as determined by SDS-PAGE and Coomassie blue staining

Gene Information

• Gene Name: ASB13 ankyrin repeat and SOCS box containing 13 [ Homo sapiens ]
• Official Symbol: ASB13
• Synonyms: ASB13; ankyrin repeat and SOCS box containing 13; ankyrin repeat and SOCS box protein 13; FLJ13134; MGC19879; ankyrin repeat and SOCS box-containing 13; ankyrin repeat domain-containing SOCS box protein Asb-13
• Gene ID: 79754
• mRNA Refseq: NM_024701
• Protein Refseq: NP_078977
• UniProt ID: Q8WXK3