Recombinant Human ASB13 Protein, His-tagged

Cat.No. : ASB13-425H
Product Overview : Recombinant Human ASB13, transcript variant 1, fused with His tag at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Description : The protein encoded by this gene is a member of the ankyrin repeat and SOCS box-containing (ASB) family of proteins. They contain ankyrin repeat sequence and a SOCS box domain. The SOCS box serves to couple suppressor of cytokine signalling (SOCS) proteins and their binding partners with the elongin B and C complex, possibly targeting them for degradation. Multiple alternatively spliced transcript variants, both protein-coding and not protein-coding, have been described for this gene.
Form : Supplied as a 0.2 µM filtered solution of PBS, pH 7.4, 4M Urea
Molecular Mass : 31.4kD
AA Sequence : MNHKVHHHHHHMEPRAADGCFLGDVGFWVERTPVHEAAQRGESLQLQQLIESGACVNQVTVDSITPLHAASLQGQARCVQLLLAAGAQVDARNIDGSTPLCDACASGSIECVKLLLSYGAKVNPPLYTASPLHEACMSGSSECVRLLIDVGANLEAHDCHFGTPLHVACAREHLDCVKVLLNAGANVNAAKLHETALHHAAKVKNVDLIEMLIEFGGNIYARDNRGKKPSDYTWSSSAPAKCFEYYEKTPLTLSQ
Endotoxin : Endotoxin level is <0.1 ng/µg of protein (<1EU/µg).
Purity : >95% as determined by SDS-PAGE and Coomassie blue staining
Gene Name ASB13 ankyrin repeat and SOCS box containing 13 [ Homo sapiens ]
Official Symbol ASB13
Synonyms ASB13; ankyrin repeat and SOCS box containing 13; ankyrin repeat and SOCS box protein 13; FLJ13134; MGC19879; ankyrin repeat and SOCS box-containing 13; ankyrin repeat domain-containing SOCS box protein Asb-13;
Gene ID 79754
mRNA Refseq NM_024701
Protein Refseq NP_078977
UniProt ID Q8WXK3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ASB13 Products

Required fields are marked with *

My Review for All ASB13 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon