Recombinant Human ASB13 protein, GST-tagged
Cat.No. : | ASB13-886H |
Product Overview : | Human ASB13 full-length ORF ( NP_078977.2, 1 a.a. - 278 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The protein encoded by this gene is a member of the ankyrin repeat and SOCS box-containing (ASB) family of proteins. They contain ankyrin repeat sequence and a SOCS box domain. The SOCS box serves to couple suppressor of cytokine signalling (SOCS) proteins and their binding partners with the elongin B and C complex, possibly targeting them for degradation. Multiple alternatively spliced transcript variants, both protein-coding and not protein-coding, have been described for this gene. [provided by RefSeq, Nov 2010] |
Molecular Mass : | 56.4 kDa |
AA Sequence : | MEPRAADGCFLGDVGFWVERTPVHEAAQRGESLQLQQLIESGACVNQVTVDSITPLHAASLQGQARCVQLLLAAGAQVDARNIDGSTPLCDACASGSIECVKLLLSYGAKVNPPLYTASPLHEACMSGSSECVRLLIDVGANLEAHDCHFGTPLHVACAREHLDCVKVLLNAGANVNAAKLHETALHHAAKVKNVDLIEMLIEFGGNIYARDNRGKKPSDYTWSSSAPAKCFEYYEKTPLTLSQLCRVNLRKATGVRGLEKIAKLNIPPRLIDYLSYN |
Applications : | Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ASB13 ankyrin repeat and SOCS box containing 13 [ Homo sapiens ] |
Official Symbol | ASB13 |
Synonyms | ASB13; ankyrin repeat and SOCS box containing 13; ankyrin repeat and SOCS box protein 13; FLJ13134; MGC19879; ankyrin repeat and SOCS box-containing 13; ankyrin repeat domain-containing SOCS box protein Asb-13; |
Gene ID | 79754 |
mRNA Refseq | NM_024701 |
Protein Refseq | NP_078977 |
UniProt ID | Q8WXK3 |
◆ Recombinant Proteins | ||
ASB13-425H | Recombinant Human ASB13 Protein, His-tagged | +Inquiry |
ASB13-3925H | Recombinant Human ASB13 protein, His-tagged | +Inquiry |
ASB13-4257C | Recombinant Chicken ASB13 | +Inquiry |
ASB13-886H | Recombinant Human ASB13 protein, GST-tagged | +Inquiry |
ASB13-0067H | Recombinant Human ASB13 Protein (Met1-Asn278), N-His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ASB13-8666HCL | Recombinant Human ASB13 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ASB13 Products
Required fields are marked with *
My Review for All ASB13 Products
Required fields are marked with *