Recombinant Human ASNS protein(201-560 aa), C-His-tagged
| Cat.No. : | ASNS-2595H |
| Product Overview : | Recombinant Human ASNS protein(P08243)(201-560 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 201-560 aa |
| Form : | 0.15 M Phosphate buffered saline |
| Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| AA Sequence : | MVKYHHCRDVPLHALYDNVEKLFPGFEIETVKNNLRILFNNAVKKRLMTDRRIGCLLSGGLDSSLVAATLLKQLKEAQVQYPLQTFAIGMEDSPDLLAARKVADHIGSEHYEVLFNSEEGIQALDEVIFSLETYDITTVRASVGMYLISKYIRKNTDSVVIFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLRELYLFDVLRADRTTAAHGLELRVPFLDHRFSSYYLSLPPEMRIPKNGIEKHLLRETFEDSNLIPKEILWRPKEAFSDGITSVKNSWFKILQEYVEHQVDDAMMANAAQKFPFNTPKTKEGYYYRQVFERHYPGRADWLSHYWMPKWINATDPSARTLTHYKSAVK |
| Gene Name | ASNS asparagine synthetase (glutamine-hydrolyzing) [ Homo sapiens ] |
| Official Symbol | ASNS |
| Synonyms | ASNS; asparagine synthetase (glutamine-hydrolyzing); asparagine synthetase; asparagine synthetase [glutamine-hydrolyzing]; TS11 cell cycle control protein; glutamine-dependent asparagine synthetase; TS11; |
| Gene ID | 440 |
| mRNA Refseq | NM_001178075 |
| Protein Refseq | NP_001171546 |
| MIM | 108370 |
| UniProt ID | P08243 |
| ◆ Recombinant Proteins | ||
| Asns-31M | Recombinant Mouse Asns protein, His-tagged | +Inquiry |
| ASNS-2663C | Recombinant Chicken ASNS | +Inquiry |
| ASNS-1055HF | Recombinant Full Length Human ASNS Protein, GST-tagged | +Inquiry |
| ASNS-914H | Recombinant Human ASNS protein, GST-tagged | +Inquiry |
| ASNS-2595H | Recombinant Human ASNS protein(201-560 aa), C-His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ASNS-8650HCL | Recombinant Human ASNS 293 Cell Lysate | +Inquiry |
| ASNS-8649HCL | Recombinant Human ASNS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ASNS Products
Required fields are marked with *
My Review for All ASNS Products
Required fields are marked with *



