Recombinant Human ASNS protein(201-560 aa), C-His-tagged

Cat.No. : ASNS-2595H
Product Overview : Recombinant Human ASNS protein(P08243)(201-560 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 201-560 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : MVKYHHCRDVPLHALYDNVEKLFPGFEIETVKNNLRILFNNAVKKRLMTDRRIGCLLSGGLDSSLVAATLLKQLKEAQVQYPLQTFAIGMEDSPDLLAARKVADHIGSEHYEVLFNSEEGIQALDEVIFSLETYDITTVRASVGMYLISKYIRKNTDSVVIFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLRELYLFDVLRADRTTAAHGLELRVPFLDHRFSSYYLSLPPEMRIPKNGIEKHLLRETFEDSNLIPKEILWRPKEAFSDGITSVKNSWFKILQEYVEHQVDDAMMANAAQKFPFNTPKTKEGYYYRQVFERHYPGRADWLSHYWMPKWINATDPSARTLTHYKSAVK
Gene Name ASNS asparagine synthetase (glutamine-hydrolyzing) [ Homo sapiens ]
Official Symbol ASNS
Synonyms ASNS; asparagine synthetase (glutamine-hydrolyzing); asparagine synthetase; asparagine synthetase [glutamine-hydrolyzing]; TS11 cell cycle control protein; glutamine-dependent asparagine synthetase; TS11;
Gene ID 440
mRNA Refseq NM_001178075
Protein Refseq NP_001171546
MIM 108370
UniProt ID P08243

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ASNS Products

Required fields are marked with *

My Review for All ASNS Products

Required fields are marked with *

0

Inquiry Basket

cartIcon