Recombinant Human ASTN1, His-tagged

• Cat.No.: ASTN1-9940H
• Product Overview: Recombinant Human ASTN1(O14525)(Lys31-Arg150), fused with C-terminal His tag, was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• Protein Length: Lys31-Arg150
• Tag: C-His
• Form: Phosphate buffered saline
• Molecular Mass: 16 kDa
• Storage: Store at -20°C to -80°C.
• Reconstitution: It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
• AA Sequence: KELECKLKSITVSALPFLRENDLSIMHSPSASEPKLLFSVRNDFPGEMVVVDDLENTELPYFVLEISGNTEDIPLVRWRQQWLENGTLLFHIHHQDGAPSLPGQDPTEEPQHESAEEELR

Gene Information

• Gene Name: ASTN1 astrotactin 1 [ Homo sapiens ]
• Official Symbol: ASTN1
• Synonyms: ASTN; Astrotactin 1; ASTROTACTIN; ASTN1; KIAA0289
• Gene ID: 460
• mRNA Refseq: NM_004319.1
• Protein Refseq: NP_004310.1
• MIM: 600904
• UniProt ID: O14525