Recombinant Human ATP8B4 protein, GST-tagged

Cat.No. : ATP8B4-1017H
Product Overview : Human ATP8B4 partial ORF ( NP_079113.2, 401 a.a. - 488 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the cation transport ATPase (P-type) family and type IV subfamily. The encoded protein is involved in phospholipid transport in the cell membrane. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2013]
Molecular Mass : 35.42 kDa
AA Sequence : IMTFKRCSINGRIYGEVHDDLDQKTEITQEKEPVDFSVKSQADREFQFFDHHLMESIKMGDPKVHEFLRLLALCHTVMSEENSAGELI
Applications : Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ATP8B4 ATPase phospholipid transporting 8B4 (putative) [ Homo sapiens (human) ]
Official Symbol ATP8B4
Synonyms ATP8B4; ATPase phospholipid transporting 8B4 (putative); ATPIM; probable phospholipid-transporting ATPase IM; ATPase, class I, type 8B, member 4; P4-ATPase flippase complex alpha subunit ATP8B4; potential phospholipid-transporting ATPase IM; EC 3.6.3.1
Gene ID 79895
mRNA Refseq NM_024837
Protein Refseq NP_079113
MIM 609123
UniProt ID Q8TF62

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ATP8B4 Products

Required fields are marked with *

My Review for All ATP8B4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon