Recombinant Human ATRX protein, His-tagged
| Cat.No. : | ATRX-10066H |
| Product Overview : | Recombinant Human ATRX protein(1-87 aa), fused with N-terminal His tag, was expressed in E. coli. |
| Availability | December 21, 2025 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E. coli |
| Tag : | His |
| Protein Length : | 1-87 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | MTAEPMSESKLNTLVQKLHDFLAHSSEESEETSSPPRLAMNQNTDKISGSGSNSDMMENSKEEGTSSSEKSKSSGSSRSKRKPSIVN |
| Purity : | 90%, by SDS-PAGE. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
| Gene Name | ATRX alpha thalassemia/mental retardation syndrome X-linked [ Homo sapiens ] |
| Official Symbol | ATRX |
| Synonyms | ATRX; alpha thalassemia/mental retardation syndrome X-linked; alpha thalassemia/mental retardation syndrome X linked (RAD54 (S. cerevisiae) homolog) , JMS, Juberg Marsidi syndrome , RAD54; transcriptional regulator ATRX; RAD54 homolog (S. cerevisiae); XH2; XNP; RAD54 homolog; X-linked helicase II; Zinc finger helicase; helicase 2, X-linked; X-linked nuclear protein; ATP-dependent helicase ATRX; DNA dependent ATPase and helicase; alpha thalassemia/mental retardation syndrome X-linked (RAD54 homolog, S. cerevisiae); JMS; SHS; ATR2; SFM1; RAD54; MRXHF1; RAD54L; ZNF-HX; MGC2094; |
| mRNA Refseq | NM_000489 |
| Protein Refseq | NP_000480 |
| MIM | 300032 |
| UniProt ID | P46100 |
| Gene ID | 546 |
| ◆ Recombinant Proteins | ||
| ATRX-1289H | Recombinant Human ATRX protein, His-SUMO-tagged | +Inquiry |
| ATRX-2191M | Recombinant Mouse ATRX Protein | +Inquiry |
| ATRX-13HFL | Recombinant Full Length Human ATRX Protein, C-His-tagged | +Inquiry |
| ATRX-1535HF | Recombinant Full Length Human ATRX Protein, GST-tagged | +Inquiry |
| ATRX-10065H | Recombinant Human ATRX, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ATRX-150HCL | Recombinant Human ATRX cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ATRX Products
Required fields are marked with *
My Review for All ATRX Products
Required fields are marked with *
