"BAMBI" Related Products

Expand
Expand
Expand

Recombinant Human BAMBI protein, T7/His-tagged

Cat.No.: BAMBI-75H
Product Overview: Recombinant human BAMBI cDNA (21 – 152 aa) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGGEFVLLTKGEIRCYCDAAHCVATGYMCKSELSACFSRLLDPQNSNSPLT HGCLDSLASTTDICQAKQARNHSGTTIPTLECCHEDMCNYRGLHDVLSPPRGEASGQGNRYQHDGSRNLITKVQE LTSSKELWFRA
Purity: >90% by SDS-PAGE
Applications: 1. May be used for in vitro BAMBI protein mediated Wnt / b-catenin pathway regulation for either adipocytes or hepatocytes differentiation study with this protein as either coating matrix protein or soluble factor.2. May be used for BAMBI protein-protein interaction assay.3. As enzymatic substrate for various proteases.4. As antigen for specific antibody production.
Storage: Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name: BAMBI BMP and activin membrane-bound inhibitor homolog (Xenopus laevis) [ Homo sapiens ]
Official Symbol: BAMBI
Synonyms: BAMBI; BMP and activin membrane-bound inhibitor homolog (Xenopus laevis); BMP and activin membrane-bound inhibitor homolog; NMA; non-metastatic gene A protein; putative transmembrane protein NMA;
Gene ID: 25805
mRNA Refseq: NM_012342
Protein Refseq: NP_036474
MIM: 604444
UniProt ID: Q13145
Chromosome Location: 10p12.3-p11.2
Pathway: BMP receptor signaling, organism-specific biosystem; TGF Beta Signaling Pathway, organism-specific biosystem; TGF-beta receptor signaling, organism-specific biosystem;
Function: frizzled binding; type II transforming growth factor beta receptor binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.