Recombinant Human BARHL2 protein, GST-tagged

• Cat.No.: BARHL2-078H
• Product Overview: Human BARHL2 partial ORF ( NP_064447, 145 a.a. - 234 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 35.64 kDa
• AA Sequence: KDILGDSKPLAACAPYSTSVSSPHHTPKQESNAVHESFRPKLEQEDSKTKLDKREDSQSDIKCHGTKEEGDREITSSRESPPVRAKKPRK
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BARHL2 BarH-like homeobox 2 [ Homo sapiens ]
• Official Symbol: BARHL2
• Synonyms: BARHL2; BarH-like homeobox 2; BarH (Drosophila) like 2; barH-like 2 homeobox protein
• Gene ID: 343472
• mRNA Refseq: NM_020063
• Protein Refseq: NP_064447
• MIM: 605212
• UniProt ID: Q9NY43