Recombinant Human BARHL2 protein, GST-tagged
Cat.No. : | BARHL2-078H |
Product Overview : | Human BARHL2 partial ORF ( NP_064447, 145 a.a. - 234 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 35.64 kDa |
AA Sequence : | KDILGDSKPLAACAPYSTSVSSPHHTPKQESNAVHESFRPKLEQEDSKTKLDKREDSQSDIKCHGTKEEGDREITSSRESPPVRAKKPRK |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BARHL2 BarH-like homeobox 2 [ Homo sapiens ] |
Official Symbol | BARHL2 |
Synonyms | BARHL2; BarH-like homeobox 2; BarH (Drosophila) like 2; barH-like 2 homeobox protein; |
Gene ID | 343472 |
mRNA Refseq | NM_020063 |
Protein Refseq | NP_064447 |
MIM | 605212 |
UniProt ID | Q9NY43 |
◆ Recombinant Proteins | ||
BARHL2-078H | Recombinant Human BARHL2 protein, GST-tagged | +Inquiry |
BARHL2-942R | Recombinant Rat BARHL2 Protein | +Inquiry |
BARHL2-600R | Recombinant Rat BARHL2 Protein, His (Fc)-Avi-tagged | +Inquiry |
BARHL2-3947H | Recombinant Human BARHL2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
BARHL2-11757Z | Recombinant Zebrafish BARHL2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
BARHL2-8514HCL | Recombinant Human BARHL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BARHL2 Products
Required fields are marked with *
My Review for All BARHL2 Products
Required fields are marked with *
0
Inquiry Basket