Recombinant Human BAZ1A Protein, GST-tagged

• Cat.No.: BAZ1A-096H
• Product Overview: Human BAZ1A partial ORF ( NP_038476, 1457 a.a. - 1556 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 36.74 kDa
• AA Sequence: LVSKIQVPDYYDIIKKPIALNIIREKVNKCEYKLASEFIDDIELMFSNCFEYNPRNTSEAKAGTRLQAFFHIQAQKLGLHVTPSNVDQVSTPPAAKKSRI
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BAZ1A bromodomain adjacent to zinc finger domain, 1A [ Homo sapiens ]
• Official Symbol: BAZ1A
• Synonyms: BAZ1A; bromodomain adjacent to zinc finger domain, 1A; bromodomain adjacent to zinc finger domain protein 1A; ACF1; hACF1; WALp1; WCRF180; hWALp1; CHRAC subunit ACF1; ATP-dependent chromatin remodeling protein; ATP-dependent chromatin-remodeling protein; ATP-utilizing chromatin assembly and remodeling factor 1; williams syndrome transcription factor-related chromatin-remodeling factor 180; FLJ14383; DKFZp586E0518
• Gene ID: 11177
• mRNA Refseq: NM_013448
• Protein Refseq: NP_038476
• MIM: 605680
• UniProt ID: Q9NRL2