"BAZ1A" Related Products

Recombinant Human BAZ1A Protein, GST-tagged

Cat.No. : BAZ1A-096H
Product Overview : Human BAZ1A partial ORF ( NP_038476, 1457 a.a. - 1556 a.a.) recombinant protein with GST-tag at N-terminal.
Source : Wheat Germ
Species : Human
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.74 kDa
AA Sequence : LVSKIQVPDYYDIIKKPIALNIIREKVNKCEYKLASEFIDDIELMFSNCFEYNPRNTSEAKAGTRLQAFFHIQAQKLGLHVTPSNVDQVSTPPAAKKSRI
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name : BAZ1A bromodomain adjacent to zinc finger domain, 1A [ Homo sapiens ]
Official Symbol : BAZ1A
Synonyms : BAZ1A; bromodomain adjacent to zinc finger domain, 1A; bromodomain adjacent to zinc finger domain protein 1A; ACF1; hACF1; WALp1; WCRF180; hWALp1; CHRAC subunit ACF1; ATP-dependent chromatin remodeling protein; ATP-dependent chromatin-remodeling protein; ATP-utilizing chromatin assembly and remodeling factor 1; williams syndrome transcription factor-related chromatin-remodeling factor 180; FLJ14383; DKFZp586E0518;
Gene ID : 11177
mRNA Refseq : NM_013448
Protein Refseq : NP_038476
MIM : 605680
UniProt ID : Q9NRL2

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.