Recombinant Human BAZ1A Protein, GST-tagged
Cat.No. : | BAZ1A-096H |
Product Overview : | Human BAZ1A partial ORF ( NP_038476, 1457 a.a. - 1556 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | LVSKIQVPDYYDIIKKPIALNIIREKVNKCEYKLASEFIDDIELMFSNCFEYNPRNTSEAKAGTRLQAFFHIQAQKLGLHVTPSNVDQVSTPPAAKKSRI |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BAZ1A bromodomain adjacent to zinc finger domain, 1A [ Homo sapiens ] |
Official Symbol | BAZ1A |
Synonyms | BAZ1A; bromodomain adjacent to zinc finger domain, 1A; bromodomain adjacent to zinc finger domain protein 1A; ACF1; hACF1; WALp1; WCRF180; hWALp1; CHRAC subunit ACF1; ATP-dependent chromatin remodeling protein; ATP-dependent chromatin-remodeling protein; ATP-utilizing chromatin assembly and remodeling factor 1; williams syndrome transcription factor-related chromatin-remodeling factor 180; FLJ14383; DKFZp586E0518; |
Gene ID | 11177 |
mRNA Refseq | NM_013448 |
Protein Refseq | NP_038476 |
MIM | 605680 |
UniProt ID | Q9NRL2 |
◆ Recombinant Proteins | ||
BAZ1A-56H | Recombinant Human BAZ1A protein, His-tagged | +Inquiry |
BAZ1A-55H | Recombinant Human BAZ1A protein, GST-tagged | +Inquiry |
BAZ1A-25H | Recombinant Human BAZ1A Protein, GST-tagged | +Inquiry |
BAZ1A-096H | Recombinant Human BAZ1A Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All BAZ1A Products
Required fields are marked with *
My Review for All BAZ1A Products
Required fields are marked with *
0
Inquiry Basket