Recombinant Human BAZ1B Protein, GST-tagged

• Cat.No.: BAZ1B-097H
• Product Overview: Human BAZ1B partial ORF ( NP_075381, 1384 a.a. - 1483 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes a member of the bromodomain protein family. The bromodomain is a structural motif characteristic of proteins involved in chromatin-dependent regulation of transcription. This gene is deleted in Williams-Beuren syndrome, a developmental disorder caused by deletion of multiple genes at 7q11.23.
• Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
• Molecular Mass: 36.74 kDa
• AA Sequence: MDFQTVQNKCSCGSYRSVQEFLTDMKQVFTNAEVYNCRGSHVLSCMVKTEQCLVALLHKHLPGHPYVRRKRKKFPDRLAEDEGDSEPEAVGQSRGRRQKK
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: BAZ1B bromodomain adjacent to zinc finger domain, 1B [ Homo sapiens ]
• Official Symbol: BAZ1B
• Synonyms: BAZ1B; bromodomain adjacent to zinc finger domain, 1B; WBSCR9, WBSCR10; tyrosine-protein kinase BAZ1B; transcription factor WSTF; Williams Beuren syndrome chromosome region 9; Williams Beuren syndrome chromosome region 10; WSTF; hWALp2; williams syndrome transcription factor; williams-Beuren syndrome chromosomal region 9 protein; williams-Beuren syndrome chromosomal region 10 protein; WBSCR9; WBSCR10
• Gene ID: 9031
• mRNA Refseq: NM_032408
• Protein Refseq: NP_115784
• MIM: 605681
• UniProt ID: Q9UIG0