Recombinant Human BAZ1B Protein, GST-tagged
| Cat.No. : | BAZ1B-097H |
| Product Overview : | Human BAZ1B partial ORF ( NP_075381, 1384 a.a. - 1483 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | This gene encodes a member of the bromodomain protein family. The bromodomain is a structural motif characteristic of proteins involved in chromatin-dependent regulation of transcription. This gene is deleted in Williams-Beuren syndrome, a developmental disorder caused by deletion of multiple genes at 7q11.23. |
| Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Molecular Mass : | 36.74 kDa |
| AA Sequence : | MDFQTVQNKCSCGSYRSVQEFLTDMKQVFTNAEVYNCRGSHVLSCMVKTEQCLVALLHKHLPGHPYVRRKRKKFPDRLAEDEGDSEPEAVGQSRGRRQKK |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | BAZ1B bromodomain adjacent to zinc finger domain, 1B [ Homo sapiens ] |
| Official Symbol | BAZ1B |
| Synonyms | BAZ1B; bromodomain adjacent to zinc finger domain, 1B; WBSCR9, WBSCR10; tyrosine-protein kinase BAZ1B; transcription factor WSTF; Williams Beuren syndrome chromosome region 9; Williams Beuren syndrome chromosome region 10; WSTF; hWALp2; williams syndrome transcription factor; williams-Beuren syndrome chromosomal region 9 protein; williams-Beuren syndrome chromosomal region 10 protein; WBSCR9; WBSCR10; |
| Gene ID | 9031 |
| mRNA Refseq | NM_032408 |
| Protein Refseq | NP_115784 |
| MIM | 605681 |
| UniProt ID | Q9UIG0 |
| ◆ Recombinant Proteins | ||
| BAZ1B-343R | Recombinant Rhesus Macaque BAZ1B Protein, His (Fc)-Avi-tagged | +Inquiry |
| BAZ1B-971M | Recombinant Mouse BAZ1B Protein, His (Fc)-Avi-tagged | +Inquiry |
| BAZ1B-32H | Recombinant Human BAZ1B, His&FLAG-tagged | +Inquiry |
| BAZ1B-097H | Recombinant Human BAZ1B Protein, GST-tagged | +Inquiry |
| BAZ1B-58H | Recombinant Human BAZ1B protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| BAZ1B-066HKCL | Human BAZ1B Knockdown Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BAZ1B Products
Required fields are marked with *
My Review for All BAZ1B Products
Required fields are marked with *



