Recombinant Human BAZ1B Protein, GST-tagged
Cat.No. : | BAZ1B-097H |
Product Overview : | Human BAZ1B partial ORF ( NP_075381, 1384 a.a. - 1483 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the bromodomain protein family. The bromodomain is a structural motif characteristic of proteins involved in chromatin-dependent regulation of transcription. This gene is deleted in Williams-Beuren syndrome, a developmental disorder caused by deletion of multiple genes at 7q11.23. |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | MDFQTVQNKCSCGSYRSVQEFLTDMKQVFTNAEVYNCRGSHVLSCMVKTEQCLVALLHKHLPGHPYVRRKRKKFPDRLAEDEGDSEPEAVGQSRGRRQKK |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BAZ1B bromodomain adjacent to zinc finger domain, 1B [ Homo sapiens ] |
Official Symbol | BAZ1B |
Synonyms | BAZ1B; bromodomain adjacent to zinc finger domain, 1B; WBSCR9, WBSCR10; tyrosine-protein kinase BAZ1B; transcription factor WSTF; Williams Beuren syndrome chromosome region 9; Williams Beuren syndrome chromosome region 10; WSTF; hWALp2; williams syndrome transcription factor; williams-Beuren syndrome chromosomal region 9 protein; williams-Beuren syndrome chromosomal region 10 protein; WBSCR9; WBSCR10; |
Gene ID | 9031 |
mRNA Refseq | NM_032408 |
Protein Refseq | NP_115784 |
MIM | 605681 |
UniProt ID | Q9UIG0 |
◆ Recombinant Proteins | ||
BAZ1B-2302M | Recombinant Mouse BAZ1B Protein | +Inquiry |
BAZ1B-3699H | Recombinant Human BAZ1B protein, His-tagged | +Inquiry |
BAZ1B-58H | Recombinant Human BAZ1B protein, His-tagged | +Inquiry |
BAZ1B-343R | Recombinant Rhesus Macaque BAZ1B Protein, His (Fc)-Avi-tagged | +Inquiry |
BAZ1B-32H | Recombinant Human BAZ1B, His&FLAG-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BAZ1B Products
Required fields are marked with *
My Review for All BAZ1B Products
Required fields are marked with *