Recombinant Human BAZ2A Protein, GST-tagged

Cat.No. : BAZ2A-098H
Product Overview : Human BAZ2A partial ORF ( NP_038477.1, 1681 a.a. - 1780 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Form : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass : 36.74 kDa
AA Sequence : PKMEAVPEGDWFCTVCLAQQVEGEFTQKPGFPKRGQKRKSGYSLNFSEGDGRRRRVLLKGRESPAAGPRYSEERLSPSKRRRLSMRNHHSDLTFCEIILM
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name BAZ2A bromodomain adjacent to zinc finger domain, 2A [ Homo sapiens ]
Official Symbol BAZ2A
Synonyms BAZ2A; bromodomain adjacent to zinc finger domain, 2A; bromodomain adjacent to zinc finger domain protein 2A; KIAA0314; TIP5; TTF I interacting peptide 5; WALp3; hWALp3; TTF-I interacting peptide 5; TTF-I-interacting protein 5; transcription termination factor I-interacting protein 5; FLJ13768; FLJ13780; FLJ45876; DKFZp781B109;
Gene ID 11176
mRNA Refseq NM_013449
Protein Refseq NP_038477
MIM 605682
UniProt ID Q9UIF9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All BAZ2A Products

Required fields are marked with *

My Review for All BAZ2A Products

Required fields are marked with *

0
cart-icon