Recombinant Human BAZ2A Protein, GST-tagged
Cat.No. : | BAZ2A-098H |
Product Overview : | Human BAZ2A partial ORF ( NP_038477.1, 1681 a.a. - 1780 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Form : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | PKMEAVPEGDWFCTVCLAQQVEGEFTQKPGFPKRGQKRKSGYSLNFSEGDGRRRRVLLKGRESPAAGPRYSEERLSPSKRRRLSMRNHHSDLTFCEIILM |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | BAZ2A bromodomain adjacent to zinc finger domain, 2A [ Homo sapiens ] |
Official Symbol | BAZ2A |
Synonyms | BAZ2A; bromodomain adjacent to zinc finger domain, 2A; bromodomain adjacent to zinc finger domain protein 2A; KIAA0314; TIP5; TTF I interacting peptide 5; WALp3; hWALp3; TTF-I interacting peptide 5; TTF-I-interacting protein 5; transcription termination factor I-interacting protein 5; FLJ13768; FLJ13780; FLJ45876; DKFZp781B109; |
Gene ID | 11176 |
mRNA Refseq | NM_013449 |
Protein Refseq | NP_038477 |
MIM | 605682 |
UniProt ID | Q9UIF9 |
◆ Recombinant Proteins | ||
BAZ2A-59H | Recombinant Human BAZ2A protein, GST-tagged | +Inquiry |
BAZ2A-098H | Recombinant Human BAZ2A Protein, GST-tagged | +Inquiry |
BAZ2A-1605Z | Recombinant Zebrafish BAZ2A | +Inquiry |
BAZ2A-60H | Recombinant Human BAZ2A protein, His-tagged | +Inquiry |
RFL22886OF | Recombinant Full Length Oryza Sativa Subsp. Japonica Probable Aquaporin Tip5-1(Tip5;1) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All BAZ2A Products
Required fields are marked with *
My Review for All BAZ2A Products
Required fields are marked with *
0
Inquiry Basket